Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2L5C Olfactory Receptor

Gene Symbol OR2L5C
Organism Dog
Family 2
Subfamily L
Pseudo No
Location chr14:1,419,380-1,420,310 (-)
Aliases cOR2L16

Sequence information


Nucleotide sequence

ATGGAAAACTATACTCAAACATCAACTGATTTCACCCTACTGGGCTTGTTCCCACCAACA
AGAATTGGCCTGTTCCTCTTTATTGTCATCGTTCTCGTTTTCCTAATGGCTCTGTTTGGC
AACCTGTCCATGATTCTTCTTATCTTCAGAGACACACATCTCCACACACCCATGTATTTC
TTACTCAGTCAGCTCTCTCTCATTGACCTAAGCTATATCTCCACGATTGTCCCCAAAATG
ACCTACAATTTTGTGTGTGGAAACAAGTCTATCTCCTTCATTGGGTGTGGAGTTCAGAGC
TACTTTTTCTTGACTTTAGCAGGTGCAGAAGCTTTGCTCCTGATATCTATGGCCTATGAT
CGTTATGTGGCTATTTGCTTTCCTCTTCACTATCCCATTCGTATGAGCAAAAAAGTATGC
ATGCTGATGATAACAGGATCTTGGATAATGGGCTCAGTCAATGCTTGTGCCCACACTGTA
TACGCCTTCCATATACCTTACTGTCGATCCAGGAACATCAACCATTTCTTCTGTGATGTC
CCAGCCATGTTGACTTTAGCCTGCATGGACACCTGGGTCTATGAGTACACAGTGTTTGTG
AGCACCATCCTCTTCCTTGCATTTCCATTCATTGGCATTGTATGTTCCTATGGCCGGGTC
CTCCTAGCTATCTGCCACATGCAGTCCACAGAAGGGAGGAAGAAGGCCTATTCCACCTGC
AGCACCCACCTTACTGTAGTGACTTTATACTATGCACCTTTTGTTTACACATATTTATGC
CCGAGATCCTTTCGATCTCCAACAGAGAACAAGGTCCTAGCTGTTTTCTACACTATCCTG
ACCCCAGTGCTCAACCCCATAATCTACTGCCTGAGAAACAAGGAGGTGATGGGAGCCCTG
AGACGATTGATTCAGAGAATCTCCTTTGTTAAAATG


Conceptual translation

MENYTQTSTDFTLLGLFPPTRIGLFLFIVIVLVFLMALFGNLSMILLIFRDTHLHTPMYF
LLSQLSLIDLSYISTIVPKMTYNFVCGNKSISFIGCGVQSYFFLTLAGAEALLLISMAYD
RYVAICFPLHYPIRMSKKVCMLMITGSWIMGSVNACAHTVYAFHIPYCRSRNINHFFCDV
PAMLTLACMDTWVYEYTVFVSTILFLAFPFIGIVCSYGRVLLAICHMQSTEGRKKAYSTC
STHLTVVTLYYAPFVYTYLCPRSFRSPTENKVLAVFYTILTPVLNPIIYCLRNKEVMGAL
RRLIQRISFVKM