Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2T4 Olfactory Receptor

Gene Symbol OR2T4
Organism Dog
Family 2
Subfamily T
Pseudo No
Location chr14:2,527,050-2,528,010 (+)
Aliases cOR2T14

Sequence information


Nucleotide sequence

ATGGAGAACATCAACTGGCTGGCTAACCACACTGGGAGGTCAGATTTCATCCTAGTGGGA
CTCTTCAATAAATCCAAACACCCAGCTCTCCTTTGTTTGGTCATTTTTGTGGTTTTCCTA
ATGGCCTTGTCTGGAAACACCATCCTGATTCTACTGATACATTCTGATTCCCACCTCCAC
ACCCCTATGTACTTTTTTATCAGCCAACTATCTCTCATGGACATGATGTATATTTCCGTT
ACTGTGCCCAAGATGCTCATGGACCAAGTCATGGGTATGAATAAGATCTCAGCCACGGAA
TGTGGGATACAGATGTTTCTCTATGTGACACTAGCAGGTTCAGAATTTTTTCTTCTAGCC
TCCATGGCCTATGACCGCTATGTGGCCATCTGCCATCCTCTCCGTTACCCTATCCTCATG
AACCATCAGGTGTTGCTCATCCTAGCATCTGGCTGCTGGTTCCTGGGCTCAGTGGATGGC
TTCTTGTTCACTCCCATCACCATGACCTTCCCCTTTTGCAGATCTCGGGAGATTCATCAT
TTCTTCTGTGAAGTCCCTGCTGTATTGAAACTCTCTTGTTCAGACACTTCCATCTATGAG
GTTTTCATGTATCTGTGCTGTGTGCTCATGCTTCTCATTCCTGTGACAGTCATTTCAGGC
TCTTACTACTTTATCCTCATCACCATCCACAGGATGAACTCAGCAGAAGGCCAGAAGAAG
GCCTTTGCCACTTGTTCTTCCCACATGACTGTGGTCATCCTCTTCTATGGGGCTGCCATT
TATACTTACATGCTCCCCAATTCCTACCATACACCTGAGAAGGACATGATGGTATCTGTC
TTTTACACCATACTCACTCCTGTGCTAAACCCTTTGATCTATAGCTTAAGAAATAAGGAT
GTTATGGGAGCGCTGAAGAAAATGCTGAATGTGGGACCTGGTTTTCAAGAAACTATAAAG


Conceptual translation

MENINWLANHTGRSDFILVGLFNKSKHPALLCLVIFVVFLMALSGNTILILLIHSDSHLH
TPMYFFISQLSLMDMMYISVTVPKMLMDQVMGMNKISATECGIQMFLYVTLAGSEFFLLA
SMAYDRYVAICHPLRYPILMNHQVLLILASGCWFLGSVDGFLFTPITMTFPFCRSREIHH
FFCEVPAVLKLSCSDTSIYEVFMYLCCVLMLLIPVTVISGSYYFILITIHRMNSAEGQKK
AFATCSSHMTVVILFYGAAIYTYMLPNSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD
VMGALKKMLNVGPGFQETIK