Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2T4B Olfactory Receptor

Gene Symbol OR2T4B
Organism Dog
Family 2
Subfamily T
Pseudo No
Location chr14:2712137-2713096 (-)
Aliases cOR2T17, cOR2T17, cOR2T19P

Sequence information


Nucleotide sequence

ATGGAGAACACTACTTGGATGGCCAACTATACTGTACGATCAGATTTTGAACTAGTGGGA
CTCTTCAGTCAATCCAAACACCCAGCTGTCCTTTGTGTGGTCATTTTCCTGGCTTTCCTG
ATGGCCCTCTCTGGAAACACCATCCTGATCCTTCTGATACACTGTGATGCTCACCTCCAC
ACCCCCATGTACTTTTTTATCACCCAGTTGTCTCTCATGGACGTGATGTACATTTCTGTC
ACTGTGCCCAAGATGCTCATGGACCAGGTCATGGGTGTGAATAAGATCTCAGCCCCTGAA
TGTGGGATGCAGATGTTTTTCTATTTGACACTAGGAGGTTCAGAATTTTTTCTTCTAGCT
GCCATGGCCTATGACCGCTATGTGGCCATCTGCCATCCACTCCGTTATCCTATCCTCATG
AACCATAGAGTGTGTCTTCTCTTGGTGTCTTCCTCCTGGATTTTGGGATCTGTAGATGGA
TTTATGCTCACTCCTGTCACCATGACCTTCCCCTTCTGCAGATCCCGAGAGATTCACCAT
TTCTTCTGTGAGGTTCCTGCTGTAATGAAGCTCTCCTGCTCAGACACTTCCCTCTATGAG
ACACTCATGTACCTGTGCTGTGTCCTCATGCTCTTCATCACTGTGACAGTCATTTTAAGC
TCCTATTCTTTCATCCTCTTTACCATCCACAGGATGAACTCAGCAGAGGGACGGAAGAAG
GCTTTTGCCACTTGTTCTTCCCACATGATGGTGGTTATCTCCTTCTATGGTGCTTCTGTC
TACACCTACATGCTCCCCACCTCCTATCACACCCCTGAGAAGGACATGATTGTATCTGTC
TTTTACACCATACTCACTCCTGTTCTAAATCCTTTAATTTATAGTCTTAGAAATAAGGAT
GTCACAAGGGGTCTAAAAAAAATGTTGAATGTGGGATCTGTCTTTCAGGAAACTCTAAAG


Conceptual translation

MENTTWMANYTVRSDFELVGLFSQSKHPAVLCVVIFLAFLMALSGNTILILLIHCDAHLH
TPMYFFITQLSLMDVMYISVTVPKMLMDQVMGVNKISAPECGMQMFFYLTLGGSEFFLLA
AMAYDRYVAICHPLRYPILMNHRVCLLLVSSSWILGSVDGFMLTPVTMTFPFCRSREIHH
FFCEVPAVMKLSCSDTSLYETLMYLCCVLMLFITVTVILSSYSFILFTIHRMNSAEGRKK
AFATCSSHMMVVISFYGASVYTYMLPTSYHTPEKDMIVSVFYTILTPVLNPLIYSLRNKD
VTRGLKKMLNVGSVFQETLK