Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2T4C Olfactory Receptor

Gene Symbol OR2T4C
Organism Dog
Family 2
Subfamily T
Pseudo No
Location chr14:2466120-2467079 (+)
Aliases cOR2T36, cOR2T36

Sequence information


Nucleotide sequence

ATGAAAAACATGAACTGGATGGCCAATTACACTGGAGAGTCTGATTTCATCCTGGTGGGA
ATCTTCAGTCAATCAAATCACCCAGCTCTCCTGTGTGTGGTCATTTTTGTAGTTTTCTTG
ATGGCTTTAACTGGGAATGCTGTCCTGATTCTTCTGATACATTTTGATGCTCACCTCCAC
ACTCCTATGTACTTTTTCATCAGCCAGTTGTCTCTCATGGATGTAATGTACATTTCTATC
ACTGTGCCCAAGATGCTCATAGACCAGATCATGGGTATAAGTAATATATCAGCCCCTGAG
TGTGGAATGCAAATGTTTCTCTATGTGACACTAGCGGGTTCAGAATGTTTTCTTCTAGCC
ACCATGGCCTATGATCGCTATATGGCCATCTGCCATCCTCTTCATTACCCTGTCCTCATG
AACCACAGATTGTGTCTTCTACTGGCATCTGGCTGCTGGTTTCTGGGATCTGTGGATGGA
TTTATGCTCACGCCCATCACTATGACGTTCCCTTTCTGCAGATCCCGGGAGATCCATCAT
TTCTTCTGTGAAGTCCCTGCTGTAATGAAGCTCTCCTGCTCAGATACCTCCCTTTATGAG
ACAGTCATGTACCTGTGCTGTGTCCTCATGCTCCTCATCCCTGTGACAGTCATTTCAAGC
TCCTATTATTTCATCCTCCTCACCATCCACAGGATGAATTTAGCAGAGGGTCAGAAGAAG
GCCTTTGCCACTTGTTCTTCCCATATGACTGTGGTCATTCTCTTCTATGGGGCTGCTGTC
TATACCTACATGCTCCCCACCTCCTATCACACCTCTGAGAAGGACATGATTGTATCTGTC
TTTTATACCATCCTCACTCCTGGATTAAATCCTTTAATCTACAGTCTCAGGAATAAGAAT
GTCATGGGAGCACTGAAGAAAATGTTGAATGTGGGACCTGTTTTTCAAGAAACTATAAAA


Conceptual translation

MKNMNWMANYTGESDFILVGIFSQSNHPALLCVVIFVVFLMALTGNAVLILLIHFDAHLH
TPMYFFISQLSLMDVMYISITVPKMLIDQIMGISNISAPECGMQMFLYVTLAGSECFLLA
TMAYDRYMAICHPLHYPVLMNHRLCLLLASGCWFLGSVDGFMLTPITMTFPFCRSREIHH
FFCEVPAVMKLSCSDTSLYETVMYLCCVLMLLIPVTVISSSYYFILLTIHRMNLAEGQKK
AFATCSSHMTVVILFYGAAVYTYMLPTSYHTSEKDMIVSVFYTILTPGLNPLIYSLRNKN
VMGALKKMLNVGPVFQETIK