Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2W1 Olfactory Receptor

Gene Symbol OR2W1
Organism Dog
Family 2
Subfamily W
Pseudo No
Location chr35:26118359-26119297 (-)
Aliases cOR2W9, cOR2W9

Sequence information


Nucleotide sequence

ATGGACCAAAACAATTATACTTCTCTACACGGTTTTGTTTTACTTGGTTTCTCTGACTAT
CCCAAACTGGAGATGGTGCTATCAGGAGTTGTCACTGTCTTTTACTTCATTACATGGGTG
GGTAACACAGCCATCATCATTGCATCTCTCCTGGATTCCTGTCTCCATACACCAATGTAT
TTTTTCCTCAGGAATTTATCTTTCCTGGATCTATGCTTCACAACCAGCATCATCCCTCAG
ATGCTGGTTAACTTGTGGGGACCTGACAAGACCATTAGCTATATAGGCTGTGTCATTCAA
CTCTATATTTATATGTGGTTGGGTTCCACCGAATGCCTCCTCCTAGCTGTTATGTCCTAT
GATCGCTTCACAGCTATCTGTAAGCCTTTGCATTATTTGATAATCATGAACCCACATTTC
TGTCTCAAGATAATAATCACAGTCTGGAGCATTAGTTTGGCCAATTCGGTAGCATTGTGT
ACACTCACCCTGAATTTGCCTCGATGTGGAAACAACCTTCTGGACCATTTCCTGTGTGAG
TTGCCAGCTATAGTCAAAATAGCTTGTATAGACACTACAACAGTTGAAATGTCTGTTTTT
GCTTTAGGCATTGTCTTTGTCCTTACACCCCTCAGCCTTATTCTTCTATCCTATGGCTAC
ATTGCCAAAGCTGTGCTGAGAATAAAGTCAAAAGCAGGCCGAAAAAAATCAATGAATACT
TGTGGATCTCATCTCACTGTTGTGTCCATCTTCTATGGAACTATAATCTACATGTACCTA
CAACCAGGTAACAGTGCCTCCTTAGACCAGGGCAAGTTCCTCACCCTCTTTTACACGATC
ATCACTCCAAGTCTGAATCCTCTCATTTATACCCTACGGAATAAGGACATGAAGAATGCA
TTGAGGAAGCTGGTGAGAGTTGACATGAATCTACAAAAT


Conceptual translation

MDQNNYTSLHGFVLLGFSDYPKLEMVLSGVVTVFYFITWVGNTAIIIASLLDSCLHTPMY
FFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYIGCVIQLYIYMWLGSTECLLLAVMSY
DRFTAICKPLHYLIIMNPHFCLKIIITVWSISLANSVALCTLTLNLPRCGNNLLDHFLCE
LPAIVKIACIDTTTVEMSVFALGIVFVLTPLSLILLSYGYIAKAVLRIKSKAGRKKSMNT
CGSHLTVVSIFYGTIIYMYLQPGNSASLDQGKFLTLFYTIITPSLNPLIYTLRNKDMKNA
LRKLVRVDMNLQN