Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR3A1H Olfactory Receptor

Gene Symbol OR3A1H
Organism Dog
Family 3
Subfamily A
Pseudo No
Location chr9:47,224,400-47,225,300 (-)
Aliases cOR3A9

Sequence information


Nucleotide sequence

ATGGACCCAGAATCCAGAACCAATGGAACAACTGTTACTGAGTTCATCCTGCTGGGCTTG
GTGGAGACACCAGGGCTACAACCAGTTGTCTTTGTAGTCTTCCTCTTTGCCTACCTGGTC
ACAGTCGGAGGCAACCTCAGCATCCTGGCTGCCATCTTGGTGGAACCCAAACTCCACACA
CCCATGTACTTCTTCCTGGGGAACCTGTCAGTGCTAGATGTTGGGTGCATCACTGTCACT
GTTCCCTCAATGTTGGCTCGCCTCTTGTCCCACAAACGTACAGTTCCCTACAGAGCCTGC
CTCACACAAATTTTCTTCTTCCATCTCTTGGCTGGTGTGGACTGCTTCCTGTTGACAGCC
ATGGCCTATGACCGATTCCTGGCCATCTGCCGGCCCCTCACCTACAGCACCCGGATGAGT
CAGACAGTCCAGAAAATATTGGTAGCTGTGTCCTGGGCTTTAGCCTTCACCAATGCACTG
ACCCACACAGTAGCCATAGCCACACTCAACTTTTGTGGTCCTAATGTGATCAACCACTTC
TACTGCGACCTCCCACAGCTCTTCCAGCTCTCCTGCTCCAGCACTCAGCTCAATGAGCTG
CTGCTCTTTGCTGTGGGTTTCATAATGGCAGGTACCCCCTTGGCTCTCATCATCACTTCC
TATGCACATGTGGCAGCTGCAGTCCTACGAATCCGCTCTGCTGAGGGCAGGAAGAAAGCT
TTCTCCACATGTGGCTCCCACCTCACAGTGGTTGGCATATTCTATGGGACAGGTGTCTTC
AGCTACATGAGGCTGGGCTCAGTGGAGGCCTCAGACAAGGACAAAGGGATTGGTATCCTC
AACACTGTCATCAGCCCCATGCTGAACCCACTCATCTATAGCCTCCGGAACCCGGATGTG
CAGGGGGCTCTGTGGCAGGTGCTCACAGGGAAGCGAGCCCTTGCA


Conceptual translation

MDPESRTNGTTVTEFILLGLVETPGLQPVVFVVFLFAYLVTVGGNLSILAAILVEPKLHT
PMYFFLGNLSVLDVGCITVTVPSMLARLLSHKRTVPYRACLTQIFFFHLLAGVDCFLLTA
MAYDRFLAICRPLTYSTRMSQTVQKILVAVSWALAFTNALTHTVAIATLNFCGPNVINHF
YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPLALIITSYAHVAAAVLRIRSAEGRKKA
FSTCGSHLTVVGIFYGTGVFSYMRLGSVEASDKDKGIGILNTVISPMLNPLIYSLRNPDV
QGALWQVLTGKRALA