Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4A39 Olfactory Receptor

Gene Symbol OR4A39
Organism Dog
Family 4
Subfamily A
Pseudo No
Location chr18:41074095-41075036 (-)
Aliases cOR4A39, cOR4A39

Sequence information


Nucleotide sequence

ATGGGAAATAATAATGTGACAGAATTTGTCCTCCTTGGCCTCACTCAGGATCCTGAGGGG
CAGAAAGCATTATTTGTCATGATTTTACTCATCTACATTGTGACAATGGTGGGCAACCTA
CTCATTGTAGTGACTGTTTTTGGCAGCCCCTCTCTGGGCTCCCCCATGTACTTTTTCCTT
GCCTATCTGTCACTTATGGATGCTGTTTATTCCACTGTCATTTCACCCAAATTGATTATA
GACTTACTCTGTGACAAAAAGACAATTTCTTTCCCAGCTTGCATGGGTCAGCTCTTTCTA
GAACACTTCTTTGGGGGTTCTGAGGTCTTCCTTCTGGTCATGATGGCCTATGATCGCTAT
GTGGCCATCTGTAGGCCACTGCATTACCTGACTGTTATGAATCGACAGGTTTGCATCCTG
CTGATAGTGGTGGCCTGGATTGGAGGTCTTGTGCACTCTATGGTTCAGCTTCTCTTTGTG
TACAGCCTCCCATTTTGTGGCCCCAATGTCATTGATCACTTTATCTGTGACATGTACCCA
TTATTAGAACTTGCCTGCACTGACACCTACTTAATAGGCCTCACTGTGATTGCCAACGGT
GGAGCAATCTGTATGGTCATCTTTATCCTTCTACTCATCTCCTATGGAGTCATTCTAAAT
TCTCTTAAAAGTCACAGTCCAGAAGGGAGGCGCAAAGCCCTGTCTACCTGCAGTTCCCAC
ACCACAGTGGTTGTCCTTTTTTTTGTTCCCTGCATTTTCATGTATGTTAGACCTGTTTCT
AACTTGCCCATTGATAAGTCTGTAACTCTGGTTTATACAGTTATCACTCCCATGTTAAAT
CCTTTAATATATACCTTGAGAAATTCAGAGATGAAAAATGCTATGGAAAAATTCTGGTGT
AAAAATTTAACAAAAGGTAGAATAAGAATGTGTCACCTAAAC


Conceptual translation

MGNNNVTEFVLLGLTQDPEGQKALFVMILLIYIVTMVGNLLIVVTVFGSPSLGSPMYFFL
AYLSLMDAVYSTVISPKLIIDLLCDKKTISFPACMGQLFLEHFFGGSEVFLLVMMAYDRY
VAICRPLHYLTVMNRQVCILLIVVAWIGGLVHSMVQLLFVYSLPFCGPNVIDHFICDMYP
LLELACTDTYLIGLTVIANGGAICMVIFILLLISYGVILNSLKSHSPEGRRKALSTCSSH
TTVVVLFFVPCIFMYVRPVSNLPIDKSVTLVYTVITPMLNPLIYTLRNSEMKNAMEKFWC
KNLTKGRIRMCHLN