Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C3 Olfactory Receptor

Gene Symbol OR4C3
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:41248990-41249895 (-)
Aliases cOR4C53, cOR4C53

Sequence information


Nucleotide sequence

ATGGAAATGCCACACAATATCACAGAATTTTTCATGCTGGGACTCTCACAGAATGCAGAG
ATACAGCGGGTCCTCTTTGTGTTTTTTTTGATCATCTATGTGGCCACGGTGTGTGGCAAC
ATGCTCACTGTGGTCACTATCACCTCCAGTCCCATGCTGGCTTCCCCCATGTATTATTTC
CTGGCCAACTTGTCCTTTATTGACACCTGTTATTCGTCCTCTATGGCTCCTAAACTCATT
GCTGACTCCTTGTGTGAGGGGAGAGCCATCTCTTTTGAGGGCTGCCTGGCTCAGCTCTTT
GGAGCCCATTTTCTGGGAGGTGTTGAGATCATTCTGCTCACGGTCATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCCTGCACTACACGACCATCATGACCAGGCATCTCTGTGCC
CTGCTGGTGGGGGTGGCTTGGTTCGGAGGCTTCCTGCATTCCCTGGTCCAGCTCCTCCTG
GTCCTTCAGCTGCCCTTCTGTGGGCCTAATGTGATCAATCACTTTGTCTGTGACTTGTAC
CCCTTGCTGGAAGTCGCCTGCACCAACACGTATGTCATCGGCGTGCTGGTGGTCGCCAAC
AGTGGTGTGATCTGCCTGTTGAACTTCCTCATGCTGGTTGCTTCCTATGCTGTCATCCTG
CGTTCCTTGAGGTACCATGGTGCGGAGGCGAGACGTAAAGCCCTGTCCACCTGTGGGGCT
CACTTCACTGTTGTTGCCCTGTTCTTTGTGCCTTGTATATTTATTTATATGCGGCCATCA
TCTACTTTGTCCATAGACAAAATAGTGTCAGTTTTTTATGGTATTTTGACACCTATGTTG
AATCCACTCATTTATACCCTAAGAAATGAAGAGGTAAAAAATGCCATGAGAAAGCTCTTC
ACTCAG


Conceptual translation

MEMPHNITEFFMLGLSQNAEIQRVLFVFFLIIYVATVCGNMLTVVTITSSPMLASPMYYF
LANLSFIDTCYSSSMAPKLIADSLCEGRAISFEGCLAQLFGAHFLGGVEIILLTVMAYDR
YVAICKPLHYTTIMTRHLCALLVGVAWFGGFLHSLVQLLLVLQLPFCGPNVINHFVCDLY
PLLEVACTNTYVIGVLVVANSGVICLLNFLMLVASYAVILRSLRYHGAEARRKALSTCGA
HFTVVALFFVPCIFIYMRPSSTLSIDKIVSVFYGILTPMLNPLIYTLRNEEVKNAMRKLF
TQ