Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C5 Olfactory Receptor

Gene Symbol OR4C5
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:41228979-41229989 (+)
Aliases cOR4C35, cOR4C35

Sequence information


Nucleotide sequence

ATGTGCCTGCAACAATTGCAATCCCTGTGCTGTTTGCAGATAAATCAATTATCCAGATGC
CAAAGTGGGTTCACAGAACAAATGAACAACGTGACGGAATTCATCCTGCTTGGCCTGACG
CAGAACCCAGATGTGCAGAAACTCTTGTTTGCTGTGTTTATAGTCATCTACTTTCTCACT
GTGGCAGGCAACTTACTCATTGTCGTGACAATCAGCACCAGCAGAGCCCTGGGCTCCCCC
ATGTATTTTTTTCTGTCTTTCCTGTCCTTCATAGATAGCTGCTGCTCTTCAACTATGGCT
CCCAAAATGATATTTGACTTACTTGCTAAAAAGAAAACTATCTCCTTCAGTGGGTGCATG
ACTCAGCTCTTTGCAGAACATTTCTTTGGGGGAGTTGAGATTATCCTGCTCACAGTGATG
GCCTATGACCGCTACGTGGCTATCTGCAAGCCCCTACACTACATGATCACAATGAACAGG
CAAATGTGTGCCAACTTGGTGGCCGTGGCCTGGGCTGGGGGATTTCTTCATGCTCTGATT
CAAATTCTTTTTATAGTCTGGTTGCCCTTCTGCGGCCCCAATGTCATTGACCATTTCATC
TGTGATCTTTTTCCTCTGCTAAAACTCTCCTGCACTGATACTCACATCTTTGGACTTTTT
GTCGCCGCCAACAGTGGGCTGATGTGTCTGCTCATTTTTTCTATTCTTGTCACCTCCTAT
GTCCTCATCCTTTACTCTCTAAGAACTCACAGTACTAAAGGACAGCGTAAGGCTCTCTCT
ACCTGTGCCTCCCATGTTACAGTAGTTGTCCTATTCTTTGTACCCTGTATATTCGTGTAC
CTTAGGCCCATGGTCACCTTCCCCATCGACAAAGCAGTGGCTGTGTTTTATACTATGATA
ACACCCATGTTAAATCCTTTAATCTATACCCTCAGAAACTCAGAAGTGAAAAATGCCATG
AGGAAGCTCTGGAGCCACAAAGTAATCTTGGGTAATAACAATTCATGTGAC


Conceptual translation

MCLQQLQSLCCLQINQLSRCQSGFTEQMNNVTEFILLGLTQNPDVQKLLFAVFIVIYFLT
VAGNLLIVVTISTSRALGSPMYFFLSFLSFIDSCCSSTMAPKMIFDLLAKKKTISFSGCM
TQLFAEHFFGGVEIILLTVMAYDRYVAICKPLHYMITMNRQMCANLVAVAWAGGFLHALI
QILFIVWLPFCGPNVIDHFICDLFPLLKLSCTDTHIFGLFVAANSGLMCLLIFSILVTSY
VLILYSLRTHSTKGQRKALSTCASHVTVVVLFFVPCIFVYLRPMVTFPIDKAVAVFYTMI
TPMLNPLIYTLRNSEVKNAMRKLWSHKVILGNNNSCD