Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4D1 Olfactory Receptor

Gene Symbol OR4D1
Organism Dog
Family 4
Subfamily D
Pseudo No
Location chr9:32818118-32819056 (+)
Aliases cOR4D14, cOR4D14

Sequence information


Nucleotide sequence

ATGGAAGCACAGAACATCACACAAGTGTTCCAGTTTGTCCTTTTAGGATTTTCACAGACC
CAGGAGCTCCAGAAATTCCTGTTCCTGGTGTTCTTATTTGTCTATGTCACCACCATTGTG
GGAAACATCCTTATCATAGTTACAGTGACTTCTGACTCTCGGCTCCACACGCCCATGTAT
TTTCTGCTCCGAAATCTGGCTGTCATAGATCTCTGCTATTCCACAGTCACTTCTCCAAAG
ATGCTGGTGGACTTCTTTCATGAGGTCCGGACCATCTCCTACCAGGGCTGCATGGCCCAG
ATCTTCTTCTTTCACCTCTTGGGTGGTGGGACTGTCTTCTTCCTTTCAGTAATGGCCTAT
GACCGCTACATAGCCATCTCCCGGCCCCTCCACTATGTCACCATCATGAACCCTCGATTG
TGTGTGGGGCTGGTGGTGGCTGCTTGGGTAGGGGGATTTGTTCACTCCATTGTCCAGCTT
GCTCTGATGCTCCCGTTACCTTTTTGTGGCCCCAACATCCTGGATAACTTCTACTGTGAT
GTCCCACAACTGCTGAGACTCGCCTGTACTGATACCTCCCTTCTGGAGTTCCTCATGATC
TCCAACAGTGGGATGTTAGTTCTCATCTGGTTCCTTCTCCTTCTGATATCTTACACGGTC
ATCCTGGTGATGCTGAGGTCCCACTCAGGGCAAGCCAAGAAGAAGGCAGCTTCCACATGT
ACCACTCACATCATTGTGGTGTCTATGATCTTCATTCCCTGTATCTATATCTACTCCCGG
CCCTTCACTCCTTTCCCCATGGACAAGGCTGTGTCCATCAGCTACACAGTTATGACCCCC
ATGCTCAACCCCATGATCTATACCCTGAGGAATCAGGAGATGCAGGCAGCCATGAAGAGA
TTAGGCAAGCGCCTCATGGTATGTAACAGAGAGTGGACT


Conceptual translation

MEAQNITQVFQFVLLGFSQTQELQKFLFLVFLFVYVTTIVGNILIIVTVTSDSRLHTPMY
FLLRNLAVIDLCYSTVTSPKMLVDFFHEVRTISYQGCMAQIFFFHLLGGGTVFFLSVMAY
DRYIAISRPLHYVTIMNPRLCVGLVVAAWVGGFVHSIVQLALMLPLPFCGPNILDNFYCD
VPQLLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTVILVMLRSHSGQAKKKAASTC
TTHIIVVSMIFIPCIYIYSRPFTPFPMDKAVSISYTVMTPMLNPMIYTLRNQEMQAAMKR
LGKRLMVCNREWT