Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4F1 Olfactory Receptor

Gene Symbol OR4F1
Organism Dog
Family 4
Subfamily F
Pseudo No
Location chr30:271755-272690 (+)
Aliases cOR4F24, cOR4F24

Sequence information


Nucleotide sequence

ATGGATGGAGGGAATCACTCGGCTGTATCTGAGTTTGTGTTCCTGGGACTCACTCACTCA
TGGGAGATCCAGCTTCTCCTTCTGGTGTTCTCCTCTGTGCTCTACGTGGCAAGCATGACT
GGAAACATCCTCATTGTGTTTTCTGTGACCATTGATCCTCACTTACACTCCCCCATGTAC
TTTCTCCTGGCCAGTCTCTCTTTCATTGACTTGGGAGCCTGCTCTGCTACCTCACCCAAG
ATGATTTATGACCTTTTCAGAAAGCACAAAGTCATCTCCTTTGGCGGCTGCATCGCCCAG
ATCTTCTTCATCCATGTCATTGGTGGCGTGGAGATGGTGCTGCTCATTGCCATGGCCTTT
GACAGATATGTGGCCATATGCAAGCCCCTCCATTATCTGACCATCATGAGCCCACGGAGG
TGCATCTTATTTCTGGCTGCTGCTTGGGCCCTTGGTGTCAGTCACTCACTGTTCCAACTG
GCATTTGTTGTTAATCTACCCTTCTGTGGTCCTAATGTGCTGGACAGCTTTTACTGTGAC
CTTCCTCGTCTCCTCAGACTGGCCTGTACAGACACCTACAGGTTGCAGTTCATGGTCACT
GTCAACAGTGGGTTTATCTGTGTTGGTTCCTTCTTCATACTCCTCATCTCCTACGTCTTC
ATCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGCTCATCCAAGGCCCTCTCCACTTTG
TCAGCTCACATCATGGTGGTCCTTTTGTTCTTTGGTCCAACCATGTTTGTCTATACATGG
CCACACCCCAAATCCCAGATGGACAAATTTCTTGCTATTTTTGATGCAGTTCTCACTCCT
TTTTTAAATCCTGTTATCTACACATTCAGGAATAAAGACATGAAGTCAGCAATGAAAAGA
GTATGCAGACAGCTAGTGATTTACAGGAAGATCTCA


Conceptual translation

MDGGNHSAVSEFVFLGLTHSWEIQLLLLVFSSVLYVASMTGNILIVFSVTIDPHLHSPMY
FLLASLSFIDLGACSATSPKMIYDLFRKHKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DRYVAICKPLHYLTIMSPRRCILFLAAAWALGVSHSLFQLAFVVNLPFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGSFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHIMVVLLFFGPTMFVYTWPHPKSQMDKFLAIFDAVLTPFLNPVIYTFRNKDMKSAMKR
VCRQLVIYRKIS