Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4K2 Olfactory Receptor

Gene Symbol OR4K2
Organism Dog
Family 4
Subfamily K
Pseudo No
Location chr30:60403-61350 (+)
Aliases cOR4K28, cOR4K24

Sequence information


Nucleotide sequence

ATGGATGCGGCCAATAAGTCTGTTTCTGAATTTGTTTTGCTGGGACTCTCTAAATCCTGG
GAACTACAGCTGTTTTTCTTCATGGTGTTTTCACTGTTTTATGTGGCAACAATCATTGGT
AATAGCCTCATAGTCATCACAGTTATAGCCGACTCTCACCTACACTCTCCTATGTATTTC
CTGCTTACTAACCTTTCTGTTCTTGATATGTCACTTGCTTCCTTTGCCACCCCTAAGATG
GTTACAGACTACCTCACTGGACATAAAACTATCTCCTTTGATGGCTGTATCACCCAGATA
TTTTTTCTACACCTTTTTACTGGTACTGAGATAATTTTACTTATGGCCATGTCCTTTGAT
AGGTATATTGCAATATGCAAACCTCTCCGCTATGCTTCAGTCATAAGTCCCTGGGTGTGT
GTTGCCCTCGTGGTGGCTTCCTGGATTGTGGGAGTCATGCATTCAATGAGCCAGGTCATA
TTTGCTCTCACATTACCATTCTGTGGTCCCAATGAAGTAGACAGCTTTTTCTGTGACCTT
CCTGTGGTGTTCCAGCTGGCTTGTGTGGATACTTATGTTCTGGGCCTCTTTATGATCTCA
ACTAGTGGCATAATTGCCTTATCCTGCTTTATTATTTTATTCAATTCATATGTTATTGTC
CTGGTTACTATCAAACATCATTCTTCAAAAGGATCATCTAAGGCTCTTACTACGTGCACA
GCTCATTTCATTGTTGTCCTTATGTTTTTTGGGCCATGCATTCTTATCTATATGTGGCCA
CTAAACAGTTTTCTTATAGATAAGATTCTGTCTGTGTTTTATACCATCTTCACTCCCATT
CTGAACCCAGTAATATATACCTTAAGGAATCAAGAAGTGAAGACAGCTATGAGGAAACTG
AAAAATAGGCTTCTAAATCCCAACAAGACAACTCCTTTGCATTATTTT


Conceptual translation

MDAANKSVSEFVLLGLSKSWELQLFFFMVFSLFYVATIIGNSLIVITVIADSHLHSPMYF
LLTNLSVLDMSLASFATPKMVTDYLTGHKTISFDGCITQIFFLHLFTGTEIILLMAMSFD
RYIAICKPLRYASVISPWVCVALVVASWIVGVMHSMSQVIFALTLPFCGPNEVDSFFCDL
PVVFQLACVDTYVLGLFMISTSGIIALSCFIILFNSYVIVLVTIKHHSSKGSSKALTTCT
AHFIVVLMFFGPCILIYMWPLNSFLIDKILSVFYTIFTPILNPVIYTLRNQEVKTAMRKL
KNRLLNPNKTTPLHYF