Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4M1 Olfactory Receptor

Gene Symbol OR4M1
Organism Dog
Family 4
Subfamily M
Pseudo No
Location chr15:17336337-17337284 (+)
Aliases cOR4M3, cOR4M3

Sequence information


Nucleotide sequence

ATGGAACCTGCAAATTACACTAGGGTGACGGAATTTGTTCTCACTGGCTTATCCCAGACT
CGAGAGGTACAACTAGTCCTATTTGTTATATTTCTGTCCTTCTATCTGTTCATCCTCCCA
GGAAATGTTCTTATTATTTGCACCATCAGGCTGGACCCTCACCTGACCTCACCCATGTAT
TTCCTGCTGGCTAACCTGGCCTTCCTTGACATTTGGTACTCCTCCATCACGGCCCCTAAA
ATGCTCGTAGACTTCTTTGTGGAAAGAAAGAGGATTTCTTTCGGTGGGTGCATTGCACAG
CTCTTCTTTTTGCACTTCGTTGGGGCCTCCGAGATGTTCCTGCTCACAGTAATGGCCTTT
GACCGCTATGCTGCTATCTGCCGCCCTCTCCACTATGCTACTATCATGAATCGACGTCTC
TGCTGTATCCTGGTGGCTCTCTCCTGGTTGGGGGGCTTCATTCATTCTATAATACAAGTG
GTCCTCATCGTCCGACTTCCCTTCTGCGGGCCCAATGAGTTAGACAGTTACTTCTGTGAT
ATCACGCAGGTCGTCCGCATTGCCTGTGCCAATACCTTCCCCGAGGAGTTAGTGATGATT
TTTAGCAGTGGTCTGATCTCTGTAGTATGCTTCATTGCTCTCCTAATGTCCTATGCCTTC
CTCCTGGCCATGTTGAGGAAACACTCAGGCTCAGGTGAGAGTACCAGTCGGGCCATGTCC
ACCTGCTATTCCCACATCACGATTGTGGTGTTCATGTTTGGACCATCTATCTACATTTAT
GCTCGACCATTTGACTCGTTTTCCCTCGATAAGGTTGTGTCTGTGTTCCATACTGTGATA
TTCCCTTTACTTAATCCCATTATCTACACCTTGAGAAATAAAGAAGTAAAGACGGCCATG
AGGAAGTTGGTCAACAGATATATTTTATGTAGAGAAGTGAAAGATAAG


Conceptual translation

MEPANYTRVTEFVLTGLSQTREVQLVLFVIFLSFYLFILPGNVLIICTIRLDPHLTSPMY
FLLANLAFLDIWYSSITAPKMLVDFFVERKRISFGGCIAQLFFLHFVGASEMFLLTVMAF
DRYAAICRPLHYATIMNRRLCCILVALSWLGGFIHSIIQVVLIVRLPFCGPNELDSYFCD
ITQVVRIACANTFPEELVMIFSSGLISVVCFIALLMSYAFLLAMLRKHSGSGESTSRAMS
TCYSHITIVVFMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKTAM
RKLVNRYILCREVKDK