Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4N2B Olfactory Receptor

Gene Symbol OR4N2B
Organism Dog
Family 4
Subfamily N
Pseudo No
Location chr15:17248138-17249061 (-)
Aliases cOR4N7, cOR4N7

Sequence information


Nucleotide sequence

ATGGAGGCAGAAAATAGCACAGTGGTGAAAGAATTCATCCTTCTTGGTCTAACCCAGTCT
CGAAATATTCAGCTCTTGGTCTTTGTGCTAGTTTTAATCTTCTATTTCATCATCCTCCCT
GGAAACTTCCTCATCATCCTCACCATCAGAACAGATCCTGGCCTCACAGCCCCCCTCTAC
TTCTTTCTGGGCAACTTGGCTTTCCTGGATGCATCCTACTCCTTCATTGTGGCTCCCAGG
ATGCTGGTGGACTTCCTTTCTGAGAAGAAGGTAATCTCCTACAGGGGTTGCATCACTCAG
CTCTTTTTCTTGCACTTCCTTGGAGGAGGGGAAGGATTACTCCTTGTTGTGATGGCCTTT
GACCGCTACATTGCCATCTGTCGGCCTTTACACTATTCAACTGTCATGAACCCTAGAGCC
TGCTATGCCTTGCTATTGGCTCTGTGGCTTGGAGGCTTTGTCCACTCCATTATCCAGGTG
GCCCTCATCCTCCGCTTGCCCTTCTGTGGCCCAAACCGACTGGATAACTTCTTCTGTGAT
GTGCCGCAGGTCATCAAGCTGGCCTGCACAGACACCTTTGTGGTGGAGCTTCTGATGGTC
TTCAATAGTGGTCTGCTCACTCTCCTGTGCTTCTTGGGGCTCTTGTCTTCCTATGCAGTC
ATCCTCTGCCATGTACATGGGTCTGCTTGTGAAGGGAAGAGCAAAGCAGTGTCCACGTGT
ACCACTCATGTCATGATTATACTTCTCATGTTTGGGCCTGCCATCTTCATCTACACTCGC
CCCTTCAGGGCTTTATCAGCTGACAAGGTAGTTTCCTTCTTTCACACTGTGATCTTTCCT
TTGTTGAATCCTGTGATTTATACCCTTCGCAACCAAGAAGTGAAAACTTCCATGAGGAGG
TTATTGAGTCGGCATGTGGTCTGC


Conceptual translation

MEAENSTVVKEFILLGLTQSRNIQLLVFVLVLIFYFIILPGNFLIILTIRTDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYSTVMNPRACYALLLALWLGGFVHSIIQVALILRLPFCGPNRLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLSSYAVILCHVHGSACEGKSKAVSTC
TTHVMIILLMFGPAIFIYTRPFRALSADKVVSFFHTVIFPLLNPVIYTLRNQEVKTSMRR
LLSRHVVC