Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4Q3B Olfactory Receptor

Gene Symbol OR4Q3B
Organism Dog
Family 4
Subfamily Q
Pseudo No
Location chr15:17288511-17289455 (+)
Aliases cOR4Q7, cOR4Q7

Sequence information


Nucleotide sequence

ATGAAAAAAAGCAATGATTCTAAGGTGACAGAATTTGTTCTTCTGGGCCTATCATCCTCC
TGGGAGCTACAGCTGTTTCTCTTCTTCATATTTTTATTGTTTTACATGACTGTTATTCTG
GGAAACCTGTTGATAATGGTAACAGTGCGAGCTGATGCTCACCTGCTCCAATCTCCCATG
TACTATTTTTTGGGTCATCTGTCTTTCATTGACCTATGCCTAGGCTGTGTTACCGTGCCC
AAGATGTTAAGAGATTTTCTACAACAAGGAAAGATCATCTCTTTTTCAGGATGTTTGACC
CAGATCTACTTCCTGCACTTTCTGGGAGCCAATGAGACATTTCTGTTGACGGTCATGGCC
TATGATAGGTATGTGGCCATATGTAATCCCTTGCACTACCTGACAGTCATGAACCGCCAG
CTGTGCTTTCAGTTGGTTTTTACCTGTTGGTTTGGGGGTTTCATCCACTCTATATCACAG
GTCACACTGGTAATCCAGCTGCCCTTCTGTGGCCCCAATGAACTGGACAACTTCTACTGT
GACGTCCCTCAGGTCATCAAGCTCGCGTGCATGGATACATATGTAGTAGAGGTGCTCATG
GTCTCAAACAGTGGTCTTCTCTCTCTCATCTGCTTCTTTGTCTTGCTGTTCTCTTACGCC
ATCATCCTGACCACTCTGAGAACTCGCTTCCACCAGGGCCGGAGCAAGGCACTCTCTACC
TGTGCCTCTCACCTAACAGTGGTCAGCCTGATCTTTGTGCCATGTGTATTCATCTACCTG
AGACCTTTCTGCAGCTTCTCCGTGGATAAGATATTCTCTGTCTTTTACACAGTGATCACA
CCTATGTTGAACCCGCTTATCTACACACTCAGAAATGCTGACATGAAGAGAGCCATGAAA
AAGCTAAGAAAAAAGTATGCGGCATTCTTCTTCCATAGTAAAGGA


Conceptual translation

MKKSNDSKVTEFVLLGLSSSWELQLFLFFIFLLFYMTVILGNLLIMVTVRADAHLLQSPM
YYFLGHLSFIDLCLGCVTVPKMLRDFLQQGKIISFSGCLTQIYFLHFLGANETFLLTVMA
YDRYVAICNPLHYLTVMNRQLCFQLVFTCWFGGFIHSISQVTLVIQLPFCGPNELDNFYC
DVPQVIKLACMDTYVVEVLMVSNSGLLSLICFFVLLFSYAIILTTLRTRFHQGRSKALST
CASHLTVVSLIFVPCVFIYLRPFCSFSVDKIFSVFYTVITPMLNPLIYTLRNADMKRAMK
KLRKKYAAFFFHSKG