Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51A1 Olfactory Receptor

Gene Symbol OR51A1
Organism Dog
Family 51
Subfamily A
Pseudo No
Location chr21:28110356-28111336 (-)
Aliases cOR51A19, cOR51A19

Sequence information


Nucleotide sequence

ATGAAGTCTCACCATGACATTTTCAATGCGTCCATTGCATTCACACCTGCAACATTCACT
CTTGCTGGCATTCCAGGGCTAGAGGCAGAACATATCTGGATATCCATCCCTTTCTGCCTG
ATATACATCATCATCTTCCTAGGAAATGGCATCATTCTTCATATCATCCGGATTGACCCT
GCTTTGCACCAACCCATGTACTCCTTTTTGGCCACGCTGGCCTTTGTTGAACTTGGGGTC
TCTGCTTCCACCATGCCCACTGTGCTAGGCATTTTCCTCTGTGGAATTAATGAAATCAGT
TTTGGTGGTTGCCTGTTCCAGATGTTTTCCATGCATTCTTTTACCATAATGGAGTCAGGT
GTCCTTCTCACTATGTCTGTAGACCGTTTTGTGGCCATCTACAGCCCCCTGCGCTACACA
ACCATCCTGACAATTCCCCGCATCATTGGGATGGGTGTCATCATTGCCTTACGAAGTGTG
GTGCTCATGTTCCCACTGCTCTTCCTCCTGAAGGGCCTGCCTTTCTGTGGTCACAATACT
CTCACACACTCTTACTGTCTCCATTCAGATCTAATCAAATTGCCCTGTGGAGACACTAGA
CCCAATAGCATCCTGGGTTTGTTTGTCATTACCTCCACATTTGGGCTGGACTCACTGCTC
ATTGTAGTTTCTTATATGTTGATTCTTCACACTGTACTGGGAATAGCTTCTGGAGCTGGG
CAGTGGAAGGCACTCAACACATGCGTGTCACACATCTGTGCTGTTCTGGTGTACTACGTG
CCCATGATTAGCCTCTCCTTGCTGCATCGCTTTGGGGGACACTTACCTCCACTCCTTCAG
ACTGTCATGGCCAATGCCTACCTCTTCTTCCCACCTGTGGTCAACCCCATTGTGTATAGT
ATGAAAACAAAAGAAATTCGCAATAGCATTGTTCGTATACTGCCTAGAAAGAGGCATGAA
GTCTCAAGACAGATAATACCC


Conceptual translation

MKSHHDIFNASIAFTPATFTLAGIPGLEAEHIWISIPFCLIYIIIFLGNGIILHIIRIDP
ALHQPMYSFLATLAFVELGVSASTMPTVLGIFLCGINEISFGGCLFQMFSMHSFTIMESG
VLLTMSVDRFVAIYSPLRYTTILTIPRIIGMGVIIALRSVVLMFPLLFLLKGLPFCGHNT
LTHSYCLHSDLIKLPCGDTRPNSILGLFVITSTFGLDSLLIVVSYMLILHTVLGIASGAG
QWKALNTCVSHICAVLVYYVPMISLSLLHRFGGHLPPLLQTVMANAYLFFPPVVNPIVYS
MKTKEIRNSIVRILPRKRHEVSRQIIP