Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51A10 Olfactory Receptor

Gene Symbol OR51A10
Organism Dog
Family 51
Subfamily A
Pseudo No
Location chr21:28,513,300-28,514,200 (+)
Aliases cOR51A22

Sequence information


Nucleotide sequence

ATGGGAAGTTTTGGGACTAACATCTCTAGCACTACCAGCTTCTCACTAACAGGCTTCCCA
GAGATGGAGGGTCTACAACACTCGTTAGCTGCCCTCCTCTTGCTGCTTTATGCTATTTCC
ATCCTGGGCAATATCCTAATCCTCGTCATTATAAAGGAGGAGCAGAGCTTGCACCAGCCT
ATGTACTACTTCTTGTCTCTGTTGTCTGTCAATGACCTGGGTGTGTCCTTTTCTACATTG
CCCACTGTATTGGCTGCCTTGTGCTTTCATGCTCCAGAGATTGCCTTTGATGCCTGCCTG
ACCCAGATGTTCTTCATCCACTTTTTCTCCTGGACAGAATCTGGGATCCTGCTGGCCATG
AGTTTTGATCGCTATGTGGCCATCTGTAACCCTCTGCGTTATTCTTCGGTGCTCACTGAT
ATCCGTGTGGCTCACATGGGCATATCCATCATCATCCGCAGCTTCTGCATGGTTTTCCCA
TTGCCTTTCCTTCTGAAGAGGCTGCCTTTCTGTAAAGCCAATGTGTTAACACATTCCTAC
TGTTTGCACCCAGACTTGATCCGCCTGCCTTGTGGAGATACCACCATCAACAGCATGTAT
GGCCTGTTCATTGTTATCTCTGCCTTTGGTGTAGACTCAGTGCTCATTCTCCTCTCCTAC
GTGCTTATACTGCACTCCATATTGGCCATTGCCTCCCAGGAGGAGAGGCTTAAGACACTC
AACACATGTGTGTCACACATATGTGCTGTGCTCATCTTCTATGTACCCATGGTTAGTGTG
TCCATGGTTCATCGATTTGGGAAGCATGCCCCTGAGTACATGCACAAGTTCATGTCCCTG
GTATATCTCTTTGTGCCTCCAATGCTCAACCCAATTATCTATTCCATTAAAACTAAAGAA
ATTCGTAAGAGGCTGTACAAAATGTTTTTGAAGCCTAATATT


Conceptual translation

MGSFGTNISSTTSFSLTGFPEMEGLQHSLAALLLLLYAISILGNILILVIIKEEQSLHQP
MYYFLSLLSVNDLGVSFSTLPTVLAALCFHAPEIAFDACLTQMFFIHFFSWTESGILLAM
SFDRYVAICNPLRYSSVLTDIRVAHMGISIIIRSFCMVFPLPFLLKRLPFCKANVLTHSY
CLHPDLIRLPCGDTTINSMYGLFIVISAFGVDSVLILLSYVLILHSILAIASQEERLKTL
NTCVSHICAVLIFYVPMVSVSMVHRFGKHAPEYMHKFMSLVYLFVPPMLNPIIYSIKTKE
IRKRLYKMFLKPNI