Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51B5 Olfactory Receptor

Gene Symbol OR51B5
Organism Dog
Family 51
Subfamily B
Pseudo No
Location chr21:28262177-28263112 (-)
Aliases cOR51B7

Sequence information


Nucleotide sequence

ATGTGGCCCAACAGCAGTTCCAGTTCCTTCCTTTTGACTGGTTTTCCAGGCTTGGAGGCA
GTTCACCACTGGATTTCCACACCCTTCTTTTTCATCTACGTCTCTATCCTTTTAGGCAAC
AGCACTCTCCTTCTTCTCATTAAGGAAGATCACAATCTTCATGAGCCTATGTACTACTTC
CTGGCCATGCTGGCAGCCACAGACCTAGGGCTGACTTTGACCACAATGCCTACAGTGTTG
GGAGTCCTCTGGTTGGATCACAGGGAGATTGGAAAAGTAGCCTGTTTTTCTCAAGCCTAC
TTTATACACTCACTTGCCTTTGTAGAATCTGGTGTTTTGCTTGCTATGGCCTATGATCGT
TTTATTGCCATTTGCAACCCCCTTAGATATAGCTCTATACTCACTAATAATCAAGTGCTG
AAAATTGGGCTAGGAGTTCTGATGAGGGGGTTTATATCTGTTGTTCCTCCAATCTTACCC
CTTTACTTTTTTCCCTATTGCCATTCTCACATCCTCTCACATGCATTCTGCCTTCACCAG
GACGTCATCAAACTGGCCTGTGCTGATACCACCTTCAATCGCCTATATCCAGTTGTGCTT
GTAGTCTTGATATTTGTGCTGGATTCTCTGATTATCCTCATCTCCTATGTGTTGATACTC
AAGAGAGTCCTGAGTATTGCCTCCAAAGAAGAGAGGGCCAAGACCCTCAACACCTGTGTC
TCCCATATCTGCTGTGTCCTGGTTTTCTATGTCACAGTGATTGGACTGTCTCTGATTCAT
CGGTTTGGAAAGCAGGTTCCACATATTGTTCACCTTACTATGAGCTACATATATTTTATT
TTCCCTCCATTAATGAATCCTATAATCTATAGTGTCAAGACCAAGCAGATCCAGATTGGC
ATTTTTCGCCTTTTCACTACCCATAGAATCAAAGTA


Conceptual translation

MWPNSSSSSFLLTGFPGLEAVHHWISTPFFFIYVSILLGNSTLLLLIKEDHNLHEPMYYF
LAMLAATDLGLTLTTMPTVLGVLWLDHREIGKVACFSQAYFIHSLAFVESGVLLAMAYDR
FIAICNPLRYSSILTNNQVLKIGLGVLMRGFISVVPPILPLYFFPYCHSHILSHAFCLHQ
DVIKLACADTTFNRLYPVVLVVLIFVLDSLIILISYVLILKRVLSIASKEERAKTLNTCV
SHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLTMSYIYFIFPPLMNPIIYSVKTKQIQIG
IFRLFTTHRIKV