Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51G1 Olfactory Receptor

Gene Symbol OR51G1
Organism Dog
Family 51
Subfamily G
Pseudo No
Location chr21:27369567-27370523 (-)
Aliases cOR51G1, cOR51G1

Sequence information


Nucleotide sequence

ATGACAATCTCTTATAATAGCAGCCTCCAAAAAGCCACTTTCTTCCTAACGGGCTTCCAA
GGTCTGGAAGATCTCCACGGCTGGATCTCTATTCCCTTCTGCTTCATCTACTTGACAGTT
ATTGTAGGAAACCTTACCATCCTCCACGTCATCCGTACTGATGTCACCCTCCATGAACCC
ATGTACTATTTCTTGGCCATGCTGGCTCTGACAGATTTGGGCCTTTGTCTATCTACACTG
CCCACTGTGTTGGGCATCTTCTGGTTTGATGCCAGAGAGATTAGCATCCCTGCCTGTTTC
ACTCAGCTCTTCTTCATCCATACTTTGTCTCTGGTAGAGTCCTCAGTTCTATTGTCCATG
TCTATTGACCGCTATGTGGCCATCTGCAACCCATTGCGTTACTCCACAGTCTTGACCCCC
ACACGTATTGTCAGGATGGGGCTGACTTCAATGCTTAGAAGTGCCCTGCTCATCCTGCCA
TTGCCATTCCTCCTTAAACGCTTCCAGTACTGCCGCTCCCATGTGCTGGCCCATGCTTAT
TGTCTGCACCTAGAGATCATGAAGCTGGCCTGCTCTAGCATCATTGTCAATCACATATAT
GGGCTCTTTGTCGTGGCCTGCACTGTTGGTGTGGATTCACTGCTCATCTTCCTCTCCTAT
GCCCTCATCGTCCGCACTGTGTTAAGCATTGCATCCCGTCAGGAGCGACTTCGGGCCCTC
AACACCTGCGTCTCCCACATCTGTGCTGTGCTACTCTTCTACATTCCTATGATTGGCTTG
TCTCTTGTGCATCGCTTTGGTGAACATCTGCCCCGTATTGTACACCTCCTCATGTCTTAT
GTGTATCTGCTGGTACCACCTCTCATGAACCCCATTGTCTACAGTATCAAGACCAAGCAA
ATCCGCATTCGCATTGCTAAGAAGTGTGACTTTGTAAAATCTCTTAGGTGTTTTCGA


Conceptual translation

MTISYNSSLQKATFFLTGFQGLEDLHGWISIPFCFIYLTVIVGNLTILHVIRTDVTLHEP
MYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREISIPACFTQLFFIHTLSLVESSVLLSM
SIDRYVAICNPLRYSTVLTPTRIVRMGLTSMLRSALLILPLPFLLKRFQYCRSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYALIVRTVLSIASRQERLRAL
NTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRIVHLLMSYVYLLVPPLMNPIVYSIKTKQ
IRIRIAKKCDFVKSLRCFR