Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51G2 Olfactory Receptor

Gene Symbol OR51G2
Organism Dog
Family 51
Subfamily G
Pseudo No
Location chr21:27360388-27361326 (-)
Aliases cOR51G2, cOR51G2

Sequence information


Nucleotide sequence

ATGACTTTGGGATCCCTGGAAAGCAGCAGCAACATTTCCTCCACCTTTCTGCTGAGTGGC
ATTCCTGGGCTGGAGCACATGCACATCTGGATCTCCATCCCACTGTGCTTTATATACCTG
GTTTCCATCCTGGGTAACTGTACAATCCTTTTTATCATTAAAACAGAGCCCTCACTCCAT
GAGCCTATGTACCTCTTCTTGTCCATGCTGGCTGTGACTGACCTGGGTCTGTCACTTTGC
ACCCTCCCTACAGTGCTGGGCATCTTTTGGATTGGAGCACGAGATATTGGTCATGATGCT
TGTTTTGCTCAGCTCTTTTTTATTCACTGCTTGTCCTTCCTGGAGTCCTCTGTGCTACTA
TCCATGGCCTTTGACCGCTTTGTGGCCATTTGTCGCCCCTTGCACTATGCTTCCATTCTC
ACCAACACTGTCATTGGCAGGATTGGCCTGGCTTCCCTAGGCCGCAGTGTAGCACTCATT
TTTCCATTGCCTTTTATGCTCAAAAGATTCCCCTATTGTGGCTCTCCAGTTCTCTCACAT
TCTTATTGTCTCCACCAGGAAGTGATGAAATTGGCCTGTGCAGACATCAAAGCCAACAGT
GTCTATGGGATGTTTGTCATTGTTTCAACAGTGGGTATAGACTCACTGCTCATTCTCTTC
TCTTATGCCCTGATCCTGCGTACTGTGCTGTCCATTGCATCCAGGGCTGAGAGATTCAAA
GCTCTTAACACCTGTGTTTCTCACATATGTGCTGTGCTCCTCTTCTACACTCCCATGATT
GGCTTGTCTGTCATCCACCGCTTTGGGAAGCAGGGATCTCATCTGGTCCAGGTGATCATG
GGCTTTGTATACCTTCTATTCCCTCCTCTGATGAACCCCATCGTCTACAGTGTGAAGACC
AAACAGATCCGAGATCGTGTAACCCATGCTTTTTGTTGC


Conceptual translation

MTLGSLESSSNISSTFLLSGIPGLEHMHIWISIPLCFIYLVSILGNCTILFIIKTEPSLH
EPMYLFLSMLAVTDLGLSLCTLPTVLGIFWIGARDIGHDACFAQLFFIHCLSFLESSVLL
SMAFDRFVAICRPLHYASILTNTVIGRIGLASLGRSVALIFPLPFMLKRFPYCGSPVLSH
SYCLHQEVMKLACADIKANSVYGMFVIVSTVGIDSLLILFSYALILRTVLSIASRAERFK
ALNTCVSHICAVLLFYTPMIGLSVIHRFGKQGSHLVQVIMGFVYLLFPPLMNPIVYSVKT
KQIRDRVTHAFCC