Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51I2P Olfactory Receptor

Gene Symbol OR51I2P
Organism Dog
Family 51
Subfamily I
Pseudo Yes
Location chr21:28525484-28526401 (-)
Aliases cOR51I5, cOR51I5

Sequence information


Nucleotide sequence

AGTCATCCTGCTTCCTTCCTCCTGACTGGCATCCCTGGTCTGGAGAGCTCTCACTCCTGG
CTAGCAGGGCCCCTCTGTGTGATGTATGCCGTGGCCCTCGGAGGCAACACTGTGATCCTA
CAGGCCGTGCGAGTGGAGCCCAGTCTCCACGAGCCCATGTACTACTTCCTGTCCATGCTG
TCCTTCAGTGACGTGGCCATGTCCATGGCCACCCTGCCCACCGTGCTCAGAACCTTCTGC
CTCAACGCCCGCAGCATTGCTTTTGATGCCTGTCTGATCCAGATGTTTCTCATTCATTCC
TTCTCCATGATGGAGTCAGGGATTCTGCTGGCCATGAGCTTTGACCGCTATGTGGCCATT
TGTGATCCTTTGCACTATGCCACTGTGCTCACCAATGGAGTCATTGCTGGAATCGGCGTA
GCTGTGACTGCCCGGAGCTTCATCACCCTCTTTCCCCTTCCCTTCCTCTTCAAGAGGCTG
CCTGTCTGCAGATCCAATGTTCTTTCTCACTCCTATTGCCTGCACCCAGACATGATGAAG
CTAGCCTGTGCTGATATCACTATCAACAGCATCTATGGACTCTTTGTTCTTGTATCTACC
TTTGGCATGGACATGTTTTTTATTTTCCTCTCCTATGTGCTCATTCTGCGTTCAGTCATG
GCCATCGCTTCCCGCAAGGAACGCCTGAAAGCTCTCAACACATGTGTGTCACATATCTTG
GTTGTATTAGCATTTTATGTACCAATGATTGGGGTTTCTGTAGTCCACCGCTTTGGGAAG
CATGCCCCACGCTACATACATGTCCTCATGTCTAATGTTTACCTCTTTGTACCTCCTGTG
CTCAACCCTCTGATTTATAGTGCCAAGACAAAGGAGATCCGCCGAGCCATTGTCCGTATG
TTTCGCCCCATCAGAATG


Conceptual translation

FSHPASFLLTGIPGLESSHSWLAGPLCVMYAVALGGNTVILQAVRVEPSLHEPMYYFLSM
LSFSDVAMSMATLPTVLRTFCLNARSIAFDACLIQMFLIHSFSMMESGILLAMSFDRYVA
ICDPLHYATVLTNGVIAGIGVAVTARSFITLFPLPFLFKRLPVCRSNVLSHSYCLHPDMM
KLACADITINSIY/TLCSCIYLWHG\FFIFLSYVLILRSVMAIASRKERLKALNTCVS
HILVVLAFYVPMIGVSVVHRFGKHAPRYIHVLMSNVYLFVPPVLNPLIYSAKTKEIRRAI
VRMFRPIRM