Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52A24 Olfactory Receptor

Gene Symbol OR52A24
Organism Dog
Family 52
Subfamily A
Pseudo No
Location chr21:28025759-28026706 (+)

Sequence information


Nucleotide sequence

ATGTCCAAGCTCAATGGCACAATCTTCATGCCCCCGGTGCTGACACTGATTGGGATCCCC
GGCTTGGAGTCTGTGCAGTTCTGGATTGGAATTCCTTTCTGTGCCATGTACATCATTGCT
CTGTTTGGGAATTCCCTGCTCCTGGTCATCATCAAATCAGAACGCAGCCTCCATGAGCCC
ATGTATCTCTTCCTGGCAATGCTTGGAGTCACAGACATTGTTCTCAGCACCTGCATCCTA
CCAAAAATGCTAGGCATCTTCTGGTTTCATCTGCCTGACATATACTTTGATGCCTGTCTC
TTTCAGATGTGGCTTATCCACACCTTCCAATCCATTGAATCAGGAATTCTGTTCGCCATG
GCCCTGGACCGCTACGTGGCCATCTGTGATCCCCTGAGACACGCATCCATCTTTACACAC
AAACTTCTCACTCAGATTGGAGTGGGAGTGACACTCAGAGCAGCCCTCCTTGTAGCTCCA
TGTCTCATCCTCATCAAATGTCGGCTGAAACACTTCCGGACCACTGTGGTCTCCCATTCA
TACTGTGAGCACATGGCCATTGTGAAGTTGGCAGCAGAAGACATTCGAGTCAACAAGGTC
TGTGGTCTCTTTGTGGCCTTCACTCTACTTGGATTTGACATAATCTTCATCACCCTCTCC
TACATCCGAATATTTATAACTGTCTTCAATCTGCCTCAGAGGGAAGCTAGGCTCAAAGCC
TTCAACACCTGCATTGCCCATATTTGCGTCTTCCTTGAGTTTTATCTCCTTGGTTTCTTC
TCCTTCTTTACACACAGGTTTGGGTTCCATATTCCACCCTACATTCATATTCTTCTGTCC
AACCTTTACCTGCTTGTCCCTCCTTTGCTCAATCCTATAGTGTATGGGGTGAAGACCAAA
CAGATTCGAGATCGAGTGTCCAAGGTTTTCCACTCTAAAGATTCATCT


Conceptual translation

MSKLNGTIFMPPVLTLIGIPGLESVQFWIGIPFCAMYIIALFGNSLLLVIIKSERSLHEP
MYLFLAMLGVTDIVLSTCILPKMLGIFWFHLPDIYFDACLFQMWLIHTFQSIESGILFAM
ALDRYVAICDPLRHASIFTHKLLTQIGVGVTLRAALLVAPCLILIKCRLKHFRTTVVSHS
YCEHMAIVKLAAEDIRVNKVCGLFVAFTLLGFDIIFITLSYIRIFITVFNLPQREARLKA
FNTCIAHICVFLEFYLLGFFSFFTHRFGFHIPPYIHILLSNLYLLVPPLLNPIVYGVKTK
QIRDRVSKVFHSKDSS