Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52A5 Olfactory Receptor

Gene Symbol OR52A5
Organism Dog
Family 52
Subfamily A
Pseudo No
Location chr21:27987233-27988180 (+)
Aliases cOR52A19, cOR52A19

Sequence information


Nucleotide sequence

ATGTTCAAGCTCAATGGCACAATCTTCATGCCCCCGGTGCTGACACTGATTGGGATTCCC
GGCTTGGAGTCTGTGCAGTTCTGGATTGGAATTCCTTTCTGTGCCATGTACATCATTGCT
CTGTTTGGGAATTCCCTGCTCCTGGTCATCATCAAATCAGAACGCAGCCTCCATGAGCCC
ATGTATCTCTTCCTGGCAATGCTTGGAGCAACAGACATTGCTCTCAGCACCTGCATCCTA
CCAAAAATGCTAGGCATCTTCTGGTTTCATCTGCCTGACATATACTTTGATGCCTGTCTC
TTTCAGATGTGGCTTATCCACACCTTCCAATGCATTGAATCAGGAATTCTGCTGGCCATG
GCCCTGGACCGCTATGTGGCCATCTGTGATCCCCTGAGACATGCAACCATCTTTACACAC
AAACTTCTCACTCAAATTGGAGTGGGAGTGATGCTCAGAGCAGCCCTCCTTGGAGCTCCA
TGTCTCATCCTCATCAAATGTCGGCTGAAACACTTCGGGACCACTGTGGTCTCCCATTCA
TACTGTGAGCACATGGCCATTGTGAAGTTGGCAGCAGAAGACATTCGAGTCAACAAGATC
TATGGTCTCTTTGTGGCCTTCACTATACTTGGATTTGACATAATCTTCATCACCCTCTCC
TACATCCGAATATTTATAACTGTCTTCAATCTGCCTCAGAGGGAAGCTAGGCTCAAAGCC
TTCAACACCTACATTGCCCATATTTGTGTCTTCCTTGAGTTTTATCTCCTTGGTTTCTTC
TCCTTCTTTACACACAGGTTTGGGTTCCATATTCCACCCTACATTCATATTCTTCTGTCC
AACCTTTACCTGCTTGTCCCTCCTTTGCTCAATCCTATAGTGTATGGGGTGAAGACCAAA
CAGATTCGAGATCGAGTGTCCAAGGTTTTCCACTCTAAAGATTCCTCT


Conceptual translation

MFKLNGTIFMPPVLTLIGIPGLESVQFWIGIPFCAMYIIALFGNSLLLVIIKSERSLHEP
MYLFLAMLGATDIALSTCILPKMLGIFWFHLPDIYFDACLFQMWLIHTFQCIESGILLAM
ALDRYVAICDPLRHATIFTHKLLTQIGVGVMLRAALLGAPCLILIKCRLKHFGTTVVSHS
YCEHMAIVKLAAEDIRVNKIYGLFVAFTILGFDIIFITLSYIRIFITVFNLPQREARLKA
FNTYIAHICVFLEFYLLGFFSFFTHRFGFHIPPYIHILLSNLYLLVPPLLNPIVYGVKTK
QIRDRVSKVFHSKDSS