Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E2 Olfactory Receptor

Gene Symbol OR52E2
Organism Dog
Family 52
Subfamily E
Pseudo No
Location chr21:27539700-27540635 (-)
Aliases cOR52E2, cOR52E2

Sequence information


Nucleotide sequence

ATGTTCCCTCCCAATAACACCCAATTCCACCTCTTTTCCTTCTTGTTGCTGGGGATCCCA
GAAATGGAAACACTGCATCTCTGGATCGGCTTTCCCTTTTGTGCTGTGTACACAATTGCA
CTCATTGGGAACTTCACTATTCTGTTTGTCATCCAGGCTGAGAGCAGCCTACACCAGCCT
ATGTTCTATTTCCTGGCCATGTTGGCTACTATTGATTTGGGTCTGTCCACAGCTACCATC
CCCAAGATGCTTGGAATCTTCTGGTTCAACCTCAGAGAGATCATCTTTGGAGCTTGCCTC
GTGCAAATGTTTTTCATTCACAGCTTCACACTTATGGAGTCAGCTGTCCTGTTGGCAATG
GCTTATGACCGCTACGTGGCCATCTGCAACCCACTTCGATATAGCACCATCCTCACCAAC
AGGGTTGTTTCTGTGATTGGTGTTGGTGTGTTAGTGAGGGCATTTATTTTTGTGATTCCT
TTTGTATTTCTGATTTTGCGATTGCCCTTCTGTGGGAATCGTGTCATTGCCCATACCTAT
TGTGAACACATGGGTCTTGCTCGTCTCTCTTGTGCCAGCATCAAGATCAATATTATTTAT
GGCTTATGTGCAATTTGTAATCTAGTATTTGACATCATAGGCATTGCCCTTTCTTATGTT
CAGATACTGCGAGCTGTTTTCCGTCTTCCTTCTCGTGAAGCCCGACTCAAATCCCTCAGC
ACGTGCAGTTCTCATGTTTGTGTAATTCTTGCCTTCTATACACCGGCCCTCTTTTCCTTT
ATGACACATCGCTTTGGCCATAATGTTCCCCGCTATATCCACATACTCCTGGCTAATCTT
TATGTTGTAGTGCCACCAATGCTCAACCCTGTCATATATGGAGTCAGGACCAAGCAGATC
TATGACCGGGTGAAGAAACTATTATTACAGAAACCA


Conceptual translation

MFPPNNTQFHLFSFLLLGIPEMETLHLWIGFPFCAVYTIALIGNFTILFVIQAESSLHQP
MFYFLAMLATIDLGLSTATIPKMLGIFWFNLREIIFGACLVQMFFIHSFTLMESAVLLAM
AYDRYVAICNPLRYSTILTNRVVSVIGVGVLVRAFIFVIPFVFLILRLPFCGNRVIAHTY
CEHMGLARLSCASIKINIIYGLCAICNLVFDIIGIALSYVQILRAVFRLPSREARLKSLS
TCSSHVCVILAFYTPALFSFMTHRFGHNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YDRVKKLLLQKP