Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52I1 Olfactory Receptor

Gene Symbol OR52I1
Organism Dog
Family 52
Subfamily I
Pseudo No
Location chr21:26977631-26978602 (+)
Aliases cOR52I2, cOR52I2

Sequence information


Nucleotide sequence

ATGTTGGGGATACCTTATAACCACACAATGGAAACCCCTGCCACCTTCTTCCTTGTGGGT
ATCCCAGGTTTGCAGTCTTCACATCTTTGGCTGGCTATTTCACTGAGTGCAACGTATATC
ATATCTCTGTTAGGAAACACACTCATAATGACTGTTATCTGGATGGATTTCACTCTACAA
GAGCCCATGTATTGCTTTCTGTATGTTTTGGCTGCCGTTGACATTGTTATGGCCTCCTCT
GTTGTACCCAAGATGGTAAGCATCTTCTTCTCAGGAGATGGCTCCATCAGCTTTAATGCT
TGTTTCACTCAGATGTATTTTGTCCATGCAGCTACATCTGTGGAGACGGGGCTACTGCTA
GCCATGGCTTTTGACCGCTATATAGCCATCTGTAAGCCCCTACACTACAAGAGAATTCTC
ACACCTAAATTGATGCTGGTAATGAGTGTGGCCATCACCATCAGAGCTGTCATATTCATG
ACTCCATTGAGTTGGATGTTAAGTCATCTGCCTTTTTGTGGCTCCAATGTGGTTCTCCAT
TCCTACTGTGAACACATAGCTGTGGCCAAGCTGGCATGTGCTGACCCCATGCCCAGTAGT
CTCTACAGTGTAATTGGCTCCTCCATTATTGTGGGCTCTGATGTAGCCCTCATTGCTGCC
TCTTATCACCTAATTCTCCGGGCAGTATGTGGTCTGGCCTCAAAGAATGCTCAGCTGAAA
GCATTAAGCACATGTGGCTCTCATGTGGGGGTTATGGCTCTGTACTATCTACCTGGGATG
GCATCAATCTATGTGGCCTGGCTAGGGAGGGATACAGTGCCTCTGCATACTCAAGTACTG
TTAGCTGATTTGTATCTGATCATTCCACCCACCTTAAACCCTATCATTTATGGCCTGAGG
ACCAAACAAATACGGAAGCGAACATGGAACTTGCTGATGAACTGCCTCTTTGACCACTCC
AAGCTGGGTTCA


Conceptual translation

MLGIPYNHTMETPATFFLVGIPGLQSSHLWLAISLSATYIISLLGNTLIMTVIWMDFTLQ
EPMYCFLYVLAAVDIVMASSVVPKMVSIFFSGDGSISFNACFTQMYFVHAATSVETGLLL
AMAFDRYIAICKPLHYKRILTPKLMLVMSVAITIRAVIFMTPLSWMLSHLPFCGSNVVLH
SYCEHIAVAKLACADPMPSSLYSVIGSSIIVGSDVALIAASYHLILRAVCGLASKNAQLK
ALSTCGSHVGVMALYYLPGMASIYVAWLGRDTVPLHTQVLLADLYLIIPPTLNPIIYGLR
TKQIRKRTWNLLMNCLFDHSKLGS