Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52J3 Olfactory Receptor

Gene Symbol OR52J3
Organism Dog
Family 52
Subfamily J
Pseudo No
Location chr21:27494740-27495675 (+)
Aliases cOR52J7, cOR52J7

Sequence information


Nucleotide sequence

ATGATATACCACAATAGGAGCATTTTTCACCCAGCCACATTCTTCCTCGTTGGAATCCCT
GGTCTGGAAGGGGCCCATGCCTGGATCTCCCTGCCTTTCTGCTCTGTTTACCTTGTGGCT
TTACTGGGCAATGCCACAATTTTGCTAGTCATCAAGATGGAGCAGACCCTGCGGAGGGAG
CCCATGTTCTATTTTCTGGCTCTCCTTTCAACTATTGATTTGGCCCTTTCCACAACCTCT
GTGCCCCGAATGTTGGGAATCTTCTGGTTTGATGCTCATGAGATTAACTTTGGAGCTTGT
GTGGCCCAGATGTTTTTGATCCATACTTTTACTGGCATGGAGGCTGAGGTCTTGCTGGCT
ATGGCCTTTGATCGCTATGTGGCCATCTGTGCTCCCCTCCACTATACAACCATCTTGACA
TCCCGAGTGCTGGTCGGCATCAGCATGTGCATTGTGATTCGTCCAGTTGTGCTGACACTT
CCCATGGTCTTCCTCATCTACCGCCTACCCTTCTGTCAGGCTCACGTGATAGCTCACTCC
TACTGTGAGCACATGGGCATTGCCAAACTCTCCTGTGGAAACATCCGTGTCAATGCCATC
TATGGGCTTTTCGTGGTTTCCTTCTTTGTCCTAAACCTGGTCCTTATTGGCATCTCCTAC
ATGTACATTCTCCGAGCTGTCTTTCGCCTCCCATCACAGGATGCTCGGCTAAAAGCACTC
AGCACATGTGGTTCTCACGTTGGGGTCATCTGTGTTTTCTATATCCCCTCAGTGTTCTCC
TTCCTCACTCACCGATTTGGACACAACATACCACGCTACATTCACATTCTTGTTGCCAAC
CTCTATTTGGTTATCCCACCATCACTCAACCCCATCATTTATGGTGTAAGGACCAAACAG
ATTCGAGAGCGAGTGCTCCATGTCTTTATAAAAAAA


Conceptual translation

MIYHNRSIFHPATFFLVGIPGLEGAHAWISLPFCSVYLVALLGNATILLVIKMEQTLRRE
PMFYFLALLSTIDLALSTTSVPRMLGIFWFDAHEINFGACVAQMFLIHTFTGMEAEVLLA
MAFDRYVAICAPLHYTTILTSRVLVGISMCIVIRPVVLTLPMVFLIYRLPFCQAHVIAHS
YCEHMGIAKLSCGNIRVNAIYGLFVVSFFVLNLVLIGISYMYILRAVFRLPSQDARLKAL
STCGSHVGVICVFYIPSVFSFLTHRFGHNIPRYIHILVANLYLVIPPSLNPIIYGVRTKQ
IRERVLHVFIKK