Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52M1 Olfactory Receptor

Gene Symbol OR52M1
Organism Dog
Family 52
Subfamily M
Pseudo No
Location chr21:26695486-26696436 (-)
Aliases cOR52M1, cOR52M1

Sequence information


Nucleotide sequence

ATGCTCACTTCTCATAATGTCTGTTCAGTACCCAGCTCCTTCCAGCTCACTGGCATCCCA
GGGCTGGAGTCCCTACATATCTGGCTTTCCATCCCCTTTGGCTCCATGTACCTAGTTGCT
GTGGTGGGGAATGTCACCATTCTGGCTGTGGTAAAGGTGGAGCATAGCCTGCATCAGCCC
ATGTATTTCTTCCTGTGTATGTTGGCTGTCATCGACCTGGTTCTGTCTACTTCTACTATG
CCCAAACTGCTGGGAATCTTCTGGTTTGGTGCTGGAGACATTGGCCTGGATGCCTGCCTA
GCTCAAATGTTCCTCATCCACTGCTTTGCCACAGTTGAGTCCGGGATCTTCCTTGCCATG
GCTTTTGACCGCTATGTAGCCATCTGCAACCCACTCCATCACACTACAGTGCTCACTCAT
ACTGTGGTAGGACGTTTGGGGCTGGCTGCCCTCCTCCGGGGTGTACTCTACATCGGACCC
CTGCCTTTGATGATCCGCCTGCGGCTGCCCCTTTACAAATCTCGTGTCATCTCCCACTCC
TACTGTGAGCACATGGCTGTGGTCACCTTGACCTGTGGTGACAGCAGGGTCAACAATGTC
TATGGGCTGAGCATTGGCTTTCTGGTCCTGATCCTGGACTCAACAGCCATTGCTGCCTCT
TATGTGATGATTTTCCGGGCTGTGATGGGGCTGGCCACTCCGGAGGCCAGGCTTAAAACC
CTGGGAACATGTGGTTCTCACATCTGTGCCATTCTGATCTTTTATGTTCCTATTGCTGTT
TCTTCTCTCATTCATCGATTTGGTCACCAGGTGCCTCCTCCAATCCACACTCTACTGGCC
AACTTCTACCTCCTCATTCCTCCAATCCTCAATCCCATTGTCTATGCTGTCCGCACCAAG
CAGATCCGAGAGCGGCTTCTCCAAATCCTCAAGATAGAAACCAAAATCAAA


Conceptual translation

MLTSHNVCSVPSSFQLTGIPGLESLHIWLSIPFGSMYLVAVVGNVTILAVVKVEHSLHQP
MYFFLCMLAVIDLVLSTSTMPKLLGIFWFGAGDIGLDACLAQMFLIHCFATVESGIFLAM
AFDRYVAICNPLHHTTVLTHTVVGRLGLAALLRGVLYIGPLPLMIRLRLPLYKSRVISHS
YCEHMAVVTLTCGDSRVNNVYGLSIGFLVLILDSTAIAASYVMIFRAVMGLATPEARLKT
LGTCGSHICAILIFYVPIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTK
QIRERLLQILKIETKIK