Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AN1D Olfactory Receptor

Gene Symbol OR5AN1D
Organism Dog
Family 5
Subfamily AN
Pseudo No
Location chr18:37432769-37433704 (+)
Aliases cOR5AN3P, cOR5AN3P

Sequence information


Nucleotide sequence

ATGACTGGAGGAGGCAATACTACAGAGATCACTTATTTCATCCTTTTGGGATTCTCTGAT
TTCCCCAGAATCCTAGCAGTGCTCTTTGCTGTATTCCTGCTGATTTACATTTTGACTCTG
ACTTGGAACCTGGGCCTCATCATCTTAATAAGGATGGACTCGCACCTCCACACGCCCATG
TACTTCTTCCCCAGTAATCTGTCCTTCATAGATGTCTGCTATGTGACCTCTACAGCTCCC
AAGATGCTCTCCAACTTTTTCCAAGAGCAACAAACCATAACCTTTGTGGGTTGTGCCGTT
CAGTACTTTGTCTTTTCAACCATGGGACTGAGTGAGTCTTGTCTCATGACAACCATGGCT
TATGACCGATACACTGCCATTTGTAATCCACTTCTCTATTCATCAGTCATGTCACCCACG
CTCTGTATTCAGATGGTGCTGGGATCCTATCTGGCTGCACTTTCTGCTTCTATATCTGAG
TTGTGTGCCTTGTTTCAGCTTCATTTCTGTGGGCTTAACGTCATCGACCACTTCTTCTGT
GACATGCCCCAACTGTTAGTCCTATCCTGCACTGACACTTTGTTTGTAAATCTCTTGACT
GCTATATTAACAATGATCTTTGGGATAATAAATGCCTTTATTATTGTGATATCCTATGGC
TTTATTGTCATGTCCATCATGAAAATCACTTCAGCTAACGGCAGATCCAAAGCTTTCAAC
ACCTGTGCTTCTCATCTGACAGCAGTTTCTCTCTTCTATACCTCAGGTATCTTTGTCTAT
TTGAGTTCCAGCTCTGGTGGTTCCTCCAGCTTTGACAGATTTGCATCAGTATTCTACACT
GTGGTTATTCCCATGTTGAATCCCTTGATTTATAGTCTGAGGAACAAGGAAATCAAAGAT
GCCTTGAAGAGGTTACAAAAGAAGAGATGGTATTGC


Conceptual translation

MTGGGNTTEITYFILLGFSDFPRILAVLFAVFLLIYILTLTWNLGLIILIRMDSHLHTPM
YFFPSNLSFIDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGLSESCLMTTMA
YDRYTAICNPLLYSSVMSPTLCIQMVLGSYLAALSASISELCALFQLHFCGLNVIDHFFC
DMPQLLVLSCTDTLFVNLLTAILTMIFGIINAFIIVISYGFIVMSIMKITSANGRSKAFN
TCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
ALKRLQKKRWYC