Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AN1E Olfactory Receptor

Gene Symbol OR5AN1E
Organism Dog
Family 5
Subfamily AN
Pseudo No
Location chr18:37358094-37359029 (+)
Aliases cOR5AN4, cOR5AN4

Sequence information


Nucleotide sequence

ATGACTGGGGGAGGAAATACTACAGAGATCACTTATTTCATCCTTTTGGGCTTCTCTGAT
TTCCCCAGAATCCTAGCAGTGCTCTTTGCTGTATTCCTGCTGATTTACATTTTGACTCTG
ACTTGGAACCTGGGCCTCATCATCTTAATAAGGATGGACTCTCACCTCCACACGCCCATG
TACTTCTTCCTCAGTAATCTGTCCTTCATAGATGTCTGCTATGTGACCTCTACAGCTCCC
AAGATGCTCTCCAACTTTTTCCAAGAGCAGCAAACCATCACCTTTGTGGGTTGTGCCGTT
CAGTACTTTGTCTTTTCAACCATGGGACTGAGTGAGTCTTGTCTCATGACAGCCATGGCT
TATGACCGATACACTGCCATTTGTAATCCACTTCTCTATTCATCAGTCATGTCACCCACA
CTCTGTATTCAGATGGTGCTGGGATCCTATCTGGCTGCACTCTCTGCTTCTATATCCCAG
TTGTGTGCCATGTTTCAGCTTCATTTCTGTGGGCTGAATGTCATCAATCACTTCTTCTGT
GACATGCCCCAACTATTAGTCCTGTCCTGCACTGACACTTTGTTTGTAAACCTCTTGACT
GCTATATTAACAATGATCTTTGGGATAATAAATGCCTTTATTATTATGATATCTTATGGC
TTTATTGTCATGTCCATCATGAAAATCACTTCAGCTAAAGGCAGATCCAAAGCTTTCAAC
ACCTGTGCTTCTCATCTGACAGCAGTTTCTCTCTTCTATACCTCAGGTATCTTTGTCTAT
TTGAGTTCCAGCTCTGGTGGTTCCTCCAGCTTTGACAGATTTGCATCAGTATTCTACACT
GTGGTTATTCCCATGTTGAACCCCTTGATTTACAGTCTGAGGAACAAGGAAATAAAAGAT
GCCTTGAAGAGGTTACCAAAGAAGACATGGTATTGT


Conceptual translation

MTGGGNTTEITYFILLGFSDFPRILAVLFAVFLLIYILTLTWNLGLIILIRMDSHLHTPM
YFFLSNLSFIDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGLSESCLMTAMA
YDRYTAICNPLLYSSVMSPTLCIQMVLGSYLAALSASISQLCAMFQLHFCGLNVINHFFC
DMPQLLVLSCTDTLFVNLLTAILTMIFGIINAFIIMISYGFIVMSIMKITSAKGRSKAFN
TCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
ALKRLPKKTWYC