Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AN1FP Olfactory Receptor

Gene Symbol OR5AN1FP
Organism Dog
Family 5
Subfamily AN
Pseudo Yes
Location chr18:37406922-37407659 (+)

Sequence information


Nucleotide sequence

GAGGGTATCAGAGATGTCTGCTATGTGACCTCTACAGCTCCCAAGATGCTCTCCAACTTT
TTCCAAGAGCAGCAAACCATCACCTTTGTGGGTTGTGCCGTTCAGTACTTTGTCTTTTCA
ACCATGGGACTGAGTGAGTCTTGTCTCATGACAGCCATGGCTTATGACCGATACACTGCC
ATTTGTAATCCACTTCTCTATTCATCAGTCATGTCACCCACGCTCTGTATTCAGATGGTG
CTGGGATCCTATCTGGCTGCACTCTCTGCTAGTATATCCCAGTTGTGTGCCATGTTTCAG
CTTCATTTCTGTGGGCCTAATGTCATCAATCACTTCTTCTGTGACATGCCCCAACTATTA
ATCCTGTCCTGCACTGACACTTTCTTTGTACATCTGTTGATTGCTATACTAGCAACGATC
TTTGGGATGATAAATGCCTTTATTATTATGATATCCTATGGCTATATTGTCATGTCCATC
ATGAAAATCACTTCAGCTAAAGGCAGATCCAAAGCTTTCAACACCTGTGCTTCTCATCTG
ACAGCAGTTTCTCTCTTCTATACCTCAAGTGTCTTTGTTTATTTGAGTTCCAGCTCTGGT
GGTTCCTCCAGCTTTGACAGATTTGCATCAGTATTCTACACTGTGGTTATTCCCATGTTG
AATCCCTTGATTTACAGTCTGAGGAACAAGGAAATAAAAGATGCCTTGAAGAGGTTACCA
AAGAAGACATGGTATTGC


Conceptual translation

EGIRDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGLSESCLMTAMAYDRYTA
ICNPLLYSSVMSPTLCIQMVLGSYLAALSASISQLCAMFQLHFCGPNVINHFFCDMPQLL
ILSCTDTFFVHLLIAILATIFGMINAFIIMISYGYIVMSIMKITSAKGRSKAFNTCASHL
TAVSLFYTSSVFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLP
KKTWYC