Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AR1 Olfactory Receptor

Gene Symbol OR5AR1
Organism Dog
Family 5
Subfamily AR
Pseudo No
Location chr18:39337259-39338191 (-)
Aliases cOR5AR1, cOR5AR1

Sequence information


Nucleotide sequence

ATGGATAAAGAAAACCACTCAGTGGTGACGGAGTTTATCTTTATGGGCATCACTCAGGAC
CGTCAGCTGCAGATCATCTTCTTTGTGATTTTCCTCCTGGTCTACCTAGTCAATGTAGTG
GGGAACATTGGTATGATCATCTTGATCATAGCAGATACTCAGCTTCACACACCCATGTAC
TTTTTCCTCTGCAACCTCTCTTTTGTTGACCTGGGCTACTCCTCAGCCATTGCCCCCAGG
ATGCTGGCTGACTTCTTAACAGAGCACAAAGTCATCTCCTTCTCTAGCTGTGCCACCCAG
TTTGCGTTCTTTGTAGGTTTTGTAGATGCTGAGTGCTATGTCCTGGCCGCCATGGCCTAT
GACCGTTTCGTGGCCATCTGCCGACCCCTCCACTATGGCACTCTCATGTCCAAGCGAGTC
TGCTTGGCCCTCATGCTGGGCTCTTACCTGGCCGGCCTGGTGAGTTTAGTGGCCCATACT
TCCCTCACCTTCAGTTTGAGCTACTGTGGTTCCAATATTATCAACCACTTCTTCTGTGAA
ATCCCACCACTCTTAGCCCTCTCTTGTTCAGATACCTACATCAGTGAGATCTTGCTGTTT
AGCCTGTGTGGCTTCATTGAATTCAGCACCATTCTTATCATCTTCATCTCCTATGCTTTC
ATACTCATCGCAATCATCAGAATGCGCTCAGCAGAAGGCCGCCTTAAGGCTTTCTCCACC
TGTGGGTCTCACCTCACTGGCGTCACCCTTTTTTATGGCACAGTCATGTTTATGTACCTG
AGGCCAACATCCAGCTACTCCCTGGACCAAGACAAGTGGGCCTCTGTGTTCTACACTATT
ATCATCCCCATGCTGAATCCCTTGATCTACAGTTTACGGAACAAGGATGTGAAAGCTGCT
TTCAAAAAACTAATTGGAAAAAAACCTCAAGAA


Conceptual translation

MDKENHSVVTEFIFMGITQDRQLQIIFFVIFLLVYLVNVVGNIGMIILIIADTQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADFLTEHKVISFSSCATQFAFFVGFVDAECYVLAAMAY
DRFVAICRPLHYGTLMSKRVCLALMLGSYLAGLVSLVAHTSLTFSLSYCGSNIINHFFCE
IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAFILIAIIRMRSAEGRLKAFST
CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAA
FKKLIGKKPQE