Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5C1 Olfactory Receptor

Gene Symbol OR5C1
Organism Dog
Family 5
Subfamily C
Pseudo No
Location chr9:59984665-59985621 (-)
Aliases cOR5C1, cOR5C1

Sequence information


Nucleotide sequence

ATGACTACAGAGAACTTCACCTGGACCAGGGTTACTCCTACTGAATTCATCCTCCTGGGC
ATCACGGATCGCTGGGACCTACGAGTGACCCTCTTCCTGATTTTCCTGCCAGTCTACCTG
GTCAGCCTGCTGGGAAATGTGGGCATGGTGCTGCTGATCCGTATGGATGCCCGGCTCCAA
ACACCTATGTACTTTTTCCTGGCCAACCTCTCCCTGCTGGATGCCTGCTATTCCTCAGCC
ATCGGCCCCAAGATGCTAGTGGACTTGCTGCTGCCCCACGCCACTATTCCTTACATAGCC
TGTGCCCTCCAGATGTTTGTGTTTGCAGGGCTGGCTGATGCTGAGTGTTGCCTGTTGGCA
GCCATGGCCTATGACCGCTATGTGGCCATCAGAAACCCTCTCCTCTACACAACAGCCATG
TCTCGGTGTGTATGCCTGGCCTTGCTGGGAGCATCAGGTCTGAGTGGGGCAGTGAGTGCC
TTTGTCCACACAACCCTCACCTTCCGCCTGAACTTCTGCCAGTCTCGGGAGGTCAACAGC
TTCTTCTGTGATATCCCTCCACTGCTGGCCATCTCTTGCAATGACACCAGTCTCAATGAG
CTCCTCCTCTTCACTGTCTGTGGCTTCATCCAGACAGCCACTGTGTTGGTCATTGCCGTG
TCATATGGTTTCATTGCTGGGGCTGTGATTCGCATGCATTCGGCAGAAGGCCGTCAGCGA
GCAGCCTCTACCTGTGGCTCTCACCTCACAGCTGTGGCCATGCTGTACGGAACACTTACT
TTCATGTACCTGCGTCCCAGCTCCAGCTATGCCCTGGATACCGACAAGATGGCATCTGTG
TTCTACACTCTTGTCATCCCAGCTCTCAACCCGCTCATCTACAGCCTCCGCAACAAGGAG
GTCAAGGAGGCAGTCAGAAAGACTTGGAGCCGATTCTGCTGCCCTGGTCCAGAGCAC


Conceptual translation

MTTENFTWTRVTPTEFILLGITDRWDLRVTLFLIFLPVYLVSLLGNVGMVLLIRMDARLQ
TPMYFFLANLSLLDACYSSAIGPKMLVDLLLPHATIPYIACALQMFVFAGLADAECCLLA
AMAYDRYVAIRNPLLYTTAMSRCVCLALLGASGLSGAVSAFVHTTLTFRLNFCQSREVNS
FFCDIPPLLAISCNDTSLNELLLFTVCGFIQTATVLVIAVSYGFIAGAVIRMHSAEGRQR
AASTCGSHLTAVAMLYGTLTFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKE
VKEAVRKTWSRFCCPGPEH