Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5F2 Olfactory Receptor

Gene Symbol OR5F2
Organism Dog
Family 5
Subfamily F
Pseudo No
Location chr18:39846318-39847286 (+)
Aliases cOR5F3, cOR5F3

Sequence information


Nucleotide sequence

ATGACCAGAAGAAACCATACTTCACTAACTGAATTCATCCTGTTGGGATTAGCAGACACA
ATGGAGCTACAGGTCATCCTCTTTTTGCTTTTTCTGGTGATTTACACACTTACTGTTTTG
GGGAATGTTGGGATGATCCTCTTAATCAGGACTGATTCCCAACTTCACACACCCATGTAT
TTCTTCCTGGCTAACTTGTCCTTTGTGGATGTTTGTTACTCCTCCACCATCACCCCAAAG
ATGCTGGTAGACTTATTGTCAGAGAAGAAAACCATCTCCTTTGCTGGCTGCTTCCTGCAA
TTGTACTTCTTCATCGCCTTGGCCACAACTGAATGCATCCTCTTTGGGTTAATGGCCTAT
GACCGCTATGTGGCCATATGCAACCCACTACTTTACTCCTTGATCATGTCCAGGACTGTC
TGCCTCAAAATGGCAGCAGGGGCTTTTACAGCAGGATTCTTGAACTCCATGGTTAACACA
AGTTATATAAGCAGCTTGCCATTCTGCAGTTCCAATGTCATTCACCACTTCTTCTGTGAC
AGCCCTCCACTTTTTAGACTCTCATGTTCTGACACACGCCTGAATGAAAGCATCTTTTCC
ACATTTGCTGGTATGAATATGGTCGGGGCTTTGTTGGTCATCCTGACCTCTTATTCCTAC
ATTCTGTTTTCAATCTTCCATATGCATTCAGGGGAGGGGAAGCGCAAAGCATTCTCAACC
TGTGGCTCTCACTTGACAGCTTTAACTCTGTTCTATGCCACCGCCATCTACACCTATCTG
AGACCTAGTTCCAGCTACTCCCTGGATAAGGACAAAGTGGCTTCTGTGTTCTACACAGTG
GTGATCCCCATGTTGAATCCTCTGATCTACAGCCTCAGGAATAGAGAAGTAAAGAAAGCT
TTATGGAATGTAACTATCAGGACAAGGATTCCCTTCATTTCTCTGATCTCCTTAGTAAAT
TTTCTGAAC


Conceptual translation

MTRRNHTSLTEFILLGLADTMELQVILFLLFLVIYTLTVLGNVGMILLIRTDSQLHTPMY
FFLANLSFVDVCYSSTITPKMLVDLLSEKKTISFAGCFLQLYFFIALATTECILFGLMAY
DRYVAICNPLLYSLIMSRTVCLKMAAGAFTAGFLNSMVNTSYISSLPFCSSNVIHHFFCD
SPPLFRLSCSDTRLNESIFSTFAGMNMVGALLVILTSYSYILFSIFHMHSGEGKRKAFST
CGSHLTALTLFYATAIYTYLRPSSSYSLDKDKVASVFYTVVIPMLNPLIYSLRNREVKKA
LWNVTIRTRIPFISLISLVNFLN