Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5I1 Olfactory Receptor

Gene Symbol OR5I1
Organism Dog
Family 5
Subfamily I
Pseudo No
Location chr18:39,968,600-39,969,600 (+)
Aliases cOR5I1

Sequence information


Nucleotide sequence

ATGGAATTGATGGATGGAAACTACACCTTGGTGACCGAGTTTATTCTTTTAGGGTTTCCG
ACCCGCCCTGAACTGCAGATTGTCCTATTCCTCGTGTTTCTGACATTGTATGGTATAATT
TTAACAGGGAATATTGGATTGATGATGTTAATCAGGACCGACCCTCACCTTCAAACCCCT
ATGTATTTTTTCCTTAGCAACCTCTCCTTTGCAGACCTTTGTTTCTCCTCAGCCATTGTT
CCCAAGATGTTGGTCAATTTCCTCTCAGAAAATAAATCTATCTCCCTTTATGGCTGTGCC
CTACAGTTTTATTTTTCCTGTGCTTTTGCTGATACAGAATCCTTTATCCTGGCTGCCATG
GCATACGATCGCTATGTTGCCATCTGTAATCCTTTACTGTATACAGTTGTGATGTCTCGG
GGCATCTGTGTATGGTTGATTGTCTTGTCCTACATTGGAGGTAACATGAGTTCCCTGGTT
CACACGTCCTTTGCCTTTATTCTGAAATACTGCGATAAAAATGTCATTAATCATTTTTTC
TGCGACCTCCCTCCCCTGCTTAAGCTATCCTGCACAGACACCTCAGTTAATGAGTGGCTT
CTCTCCACATATGGCAGCTCAGTGGAAATTTTCTGCTTCATCGTCATTGTCATCTCCTAC
TATTTCATTCTGCGCTCAGTCTTGAGGATCCGCTCTTCCAGTGGCAGAAAGAAAACCTTC
TCCACGTGTGCCTCTCACCTGACTTCTGTGGCCATCTATCAGGGGACTCTTCTCTTCATT
TACTCACGGCCCACCTATCTGTATACTCCCAACACTGATAAAATTATCTCCGTGTTCTAC
ACCATTATTATCCCAGTGCTGAATCCGTTGATTTATAGTTTGAGAAATAAAGATGTAAAA
GATGCCGCTAAGAGAGCTGTAAGGTTAAAAGTGGATTCCTCA


Conceptual translation

MELMDGNYTLVTEFILLGFPTRPELQIVLFLVFLTLYGIILTGNIGLMMLIRTDPHLQTP
MYFFLSNLSFADLCFSSAIVPKMLVNFLSENKSISLYGCALQFYFSCAFADTESFILAAM
AYDRYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFILKYCDKNVINHFF
CDLPPLLKLSCTDTSVNEWLLSTYGSSVEIFCFIVIVISYYFILRSVLRIRSSSGRKKTF
STCASHLTSVAIYQGTLLFIYSRPTYLYTPNTDKIISVFYTIIIPVLNPLIYSLRNKDVK
DAAKRAVRLKVDSS