Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5K1 Olfactory Receptor

Gene Symbol OR5K1
Organism Dog
Family 5
Subfamily K
Pseudo No
Location chr33:5,347,150-5,348,110 (+)

Sequence information


Nucleotide sequence

ATGGCTGAAGAAAATCATACCCTGAAAAGTGAGTTTATCCTCACAGGATTTACAGATCAC
CCAGAGTTGAAGACCCTTCTGTTTGTGGTGTTCTTTGCCATCTATCTCATCACCATGGTG
GGGAATCTGGGCCTGGTGGTACTGATATCAAAAGAGCATCATCTTCACATGCCAATGTAC
ATCTTTCTGGGCAACCTGGCTCTTGTGGATTCTTGCTGTGCCTCGGCCATTACTCCTAAG
ATGTTAGAGAACTTCTTTTCTGAGAACAGGATGATTTCCCTCTATGAATGCATGGCACAA
TTTTATTTTCTTTGCCTTGCTGAAACTGCAGACTGCTTTCTCCTGGCAGCAATGGCCTAT
GACCGCTATGTGGCCATCTGCAGCCCACTGCAGTACCACACCATGATGTCGAAGAAGCTC
TGCCTTCAGATGACCACAGGGGCCTACATAGCAGGAAACCTGCATTCCATGATTCACGTA
GGGCTTCTCCTTAGGCTAACTTTCTGTGGGTCTCATCAAATTAATCACTTTTACTGTGAT
ATTCTTCCTTTATACAGACTCTCCTGTATTGATCCTTATGTCAATGAACTAGTACTATTT
ATTTTTTCAGGCTCCATCCAAGTCTTCACCATAGGCAGCGTATTAATATCTTACTTCTAC
ATTCTCTTTACTATTTTCAAAATGAAATCCAAAGAAGGAAGGGTCAAAGCATTTTCCACC
TGTGCATCTCACTTTTTGTCTGTTTCATTGTTCTATGGATCTCTTTTTTTCATGTACATT
AGACCAAATTTGCTTGAACAAGGGGATAAAGATATCCCAGCTGCTATTTTGTTTACAATA
GTAGTTCCCTTACTAAATCCTTTTATTTATAGCCTGAGAAATAAAGAAGTAATAACTGTC
CTGAGAAAAATTTTGAAGAAAAAAAAATCTCATGAAAGTTGGAAACAAATGATATCGACT
GTAGCT


Conceptual translation

MAEENHTLKSEFILTGFTDHPELKTLLFVVFFAIYLITMVGNLGLVVLISKEHHLHMPMY
IFLGNLALVDSCCASAITPKMLENFFSENRMISLYECMAQFYFLCLAETADCFLLAAMAY
DRYVAICSPLQYHTMMSKKLCLQMTTGAYIAGNLHSMIHVGLLLRLTFCGSHQINHFYCD
ILPLYRLSCIDPYVNELVLFIFSGSIQVFTIGSVLISYFYILFTIFKMKSKEGRVKAFST
CASHFLSVSLFYGSLFFMYIRPNLLEQGDKDIPAAILFTIVVPLLNPFIYSLRNKEVITV
LRKILKKKKSHESWKQMISTVA