Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5L1 Olfactory Receptor

Gene Symbol OR5L1
Organism Dog
Family 5
Subfamily L
Pseudo No
Location chr18:***************** (-)
Aliases cOR5L5, cOR5L5, cOR5L6

Sequence information


Nucleotide sequence

ATGGGTGAGGAGAACTGCACCAGTGTGACAGAGTTCATTCTGCTTGGATTAGCAGATGCC
CCAGAGCTGAGAGTCTTCCTCTTCCTGCTGTTTCTTCTCATCTATGGAGTCACGGTTTTG
GGAAATCTGGGCATGATCGCAGTGATTCAGGTCAGCTCTCAGCTTCACACTCCCATGTAC
TTTTTCCTCAGCCACTTGTCCTTTGTGGATTTTTGCTACTCCACGATCATCGTGCCAAAG
ATGCTGCCCAATATCTTAAACAGGGACAAAGCCATCTCCTTCCTCGGTTGCATGGTGCAG
TTCTATTTATTTTGTACATGTGTGGTAACTGAGGTCTTCCTGTTGGCTGTGATGGCCTAT
GACCGCTTCGTGGCCATCTGCAACCCACTGCTGTACATGGTCACCATGTCCCAGAATCTC
TGTATGGAGCTGGTGTCCTGCTGCTACCTCTGTGGGACGGCCTGTTCTCTGATCCACTTG
TGTTTAGCCCTTCAGATCCCATCCTATAGATCAGATGTGATTAACCACTTCTTTTGTGAT
CTACCCCCTCTCTTATCTCTTGCTTGCTCTGATGTCACTATGAATGAATTGTTGCTGTAC
ATCGTGGCCACCTTCAACGAGCTCACCACCATCCTGATCATCCTTACCTCCTATTTGCTG
ATTCTCATCACCATCCTGAGGATGCGCTCTGCAGAGGGAAGGCGCAAAGCCTTTTCCACC
TGTGCCTCCCACCTCACAGCCATCCTTGTCTTCCATGGAACAATCCTTTTCATTTATTGT
CGGCCAGGTTCGGGCAACAGTATGGATGCTGACAAGGTGGCCACAGTGTTCTACACCATA
GTGATTCCCATGCTGAACCCCCTCATCTATAGTCTGAGGAATAAGGATGTGAAAGAAGCT
CTCAGGAAAGTGGTGAGCTCCAAAATGTTTTCC


Conceptual translation

MGEENCTSVTEFILLGLADAPELRVFLFLLFLLIYGVTVLGNLGMIAVIQVSSQLHTPMY
FFLSHLSFVDFCYSTIIVPKMLPNILNRDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYMVTMSQNLCMELVSCCYLCGTACSLIHLCLALQIPSYRSDVINHFFCD
LPPLLSLACSDVTMNELLLYIVATFNELTTILIILTSYLLILITILRMRSAEGRRKAFST
CASHLTAILVFHGTILFIYCRPGSGNSMDADKVATVFYTIVIPMLNPLIYSLRNKDVKEA
LRKVVSSKMFS