Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5L1B Olfactory Receptor

Gene Symbol OR5L1B
Organism Dog
Family 5
Subfamily L
Pseudo No
Location chr18:40078759-40079715 (-)
Aliases cOR5L4, cOR5L4

Sequence information


Nucleotide sequence

ATGGCAGAAACGGGGGAAGAGAACTGCACCAGTGTGACAGAATTCATTCTGCTTGGATTA
GCAGATGCCCCAGAGCTGAGAGTCTTCCTCTTCCTGCTGTTTCTTCTCATCTATGGAGTC
ACGGTTTTGGGAAATCTGGGCATGATCGCAGTGATCCAGGTCAGCTCTCAGCTTCACACT
CCCATGTACTTTTTCCTCAGCCACTTGTCCTTTGTGGATTTTTGCTACTCCACGATCATC
GTGCCAAAGATGCTGCCCAATATCTTAAACAGGGACAAAGCCATCTCCTTCCTCGGTTGC
ATGGTGCAGTTCTATTTATTTTGTACTTATGCAATCACTGAGGTCTTCCTGTTGGCTGTG
ATGGCCTATGACCGCTTCGTGGCCATCTGCAACCCACTGCTGTACATGGTCACCATGTCC
CAGAATCTCTGTATGGAGCTGGTGTCCTGCTGCTACCTCTGTGGGACGGCCTGTTCTCTG
ATCCACTTGTGTTTAGCCCTTCAGATCCCATCCTATAGATCAGATGTGATTAACCACTTC
TTTTGTGATCTACCCCCTCTCTTATCTCTTGCTTGCTCTGATGTCACTATGAATGAACTC
ATGGTGTCCATTGTGGCCACCTTCAACGAGATCATCACCATCATGATCATCCTCACCTCC
TATTTGCTGATTCTCATCACTATCCTGAGGATGCGCTCTGCAGAGGGAAGGCGCAAAGCC
TTTTCCACCTGTGCTTCTCACTTCACAGCCATCCTTGTCTTCCATGGAACAATCCTTTTC
AATTATTGTCGGCCCAGTTCTGGCAACAGTATGGATACTGACAAGGTGGCCACGGTGTTC
TACACCATAGTGATTCCCATGCTGAACCCTCTCATCTATAGTCTGAGGAACAAGGATGTG
AAAGAAGCTCTCAAGAAAGTATTGCGATCTAGAGTACCCTTTGAAAAACTATTTTCT


Conceptual translation

MAETGEENCTSVTEFILLGLADAPELRVFLFLLFLLIYGVTVLGNLGMIAVIQVSSQLHT
PMYFFLSHLSFVDFCYSTIIVPKMLPNILNRDKAISFLGCMVQFYLFCTYAITEVFLLAV
MAYDRFVAICNPLLYMVTMSQNLCMELVSCCYLCGTACSLIHLCLALQIPSYRSDVINHF
FCDLPPLLSLACSDVTMNELMVSIVATFNEIITIMIILTSYLLILITILRMRSAEGRRKA
FSTCASHFTAILVFHGTILFNYCRPSSGNSMDTDKVATVFYTIVIPMLNPLIYSLRNKDV
KEALKKVLRSRVPFEKLFS