Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5M10 Olfactory Receptor

Gene Symbol OR5M10
Organism Dog
Family 5
Subfamily M
Pseudo No
Location chr18:39382810-39383844 (+)
Aliases cOR5M23, cOR5M23

Sequence information


Nucleotide sequence

ATGATAAAAATGGATGGAATAAATGCAGAATCTGGATTAGACAGGATCCCTCACCTTCTC
TGCTACTCTCAGTTTTCAAGGAATAAGAAAATGTCTTCCTCGAACCACACTTCAGTGACG
GGATTCATTCTCCTGGGACTCACAGATGACCCAGTACTAGAGAAGATCCTGTTTGGGGTG
TTTCTGGTGATCTATCTAGTCACACTGGCAGGGAATCTGTGCATGATTGTACTGATCGGG
ACCAATTCCCACCTGCAAACTCCCATGTACTTCTTCCTTAGCCACCTCTCCTTTGTAGAC
ATCTGCTATTCTTCCAATATCACTCCAAACATGCTGTACAATTTCCTCTCAGACCAGAAG
ACCATCTCCTATGCTGGATGCTTCACGCAGTGTCTTCTCTTCATTGCCCTGGTGATCACT
GAGTTTTACATCCTTGCTTCAATGGCATTGGATCGCTATGTAGCCATCTGTAGCCCTCTA
CATTACAGTACCAGAATGTCCAAGAACATTTGCATCTCCCTAGTGGTGATCTCTTATACT
TGTGGTTACCTTAATGGACTCTCCCAGACACTGTTGACTTTTCACTTGTCCTTCTGTGAC
TCCCTTGAAATCAACCACTTCTACTGTGCAGATCCTCCTCTTATCCTGTTGGCCTGCTCT
GACACCCATGTCAAAAAGATGGCGATGCTGGTAGTAGCTGGCTTGACTCTGTCAAGCTCT
CTCTTCATCATTGTGCTATCCTACCTTTTCATTATTGTAGCCATCTTGAGGATCCGTTCT
GCTGAAGGCAGGCACAAAGCCTTTTCTACTTGTGCTTCCCACTTGACAACAGTCACTTTG
TTTTATGGCACCCTCTTCTGCATGTACTTAAGGAGTCCATCTGAGAAGTCTATAGAGGAG
TCTAAAATAATTGCTGTCTTTTATACATTTTTAAGCCCAATGTTGAACCCATTGATTTAT
AGTCTAAGGAACAAGGATGTGATCCATGCTATGCAGCAAATCATTCAGGGAAATATTTTT
CATAAAATTGCAGTG


Conceptual translation

MIKMDGINAESGLDRIPHLLCYSQFSRNKKMSSSNHTSVTGFILLGLTDDPVLEKILFGV
FLVIYLVTLAGNLCMIVLIGTNSHLQTPMYFFLSHLSFVDICYSSNITPNMLYNFLSDQK
TISYAGCFTQCLLFIALVITEFYILASMALDRYVAICSPLHYSTRMSKNICISLVVISYT
CGYLNGLSQTLLTFHLSFCDSLEINHFYCADPPLILLACSDTHVKKMAMLVVAGLTLSSS
LFIIVLSYLFIIVAILRIRSAEGRHKAFSTCASHLTTVTLFYGTLFCMYLRSPSEKSIEE
SKIIAVFYTFLSPMLNPLIYSLRNKDVIHAMQQIIQGNIFHKIAV