Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5P5 Olfactory Receptor

Gene Symbol OR5P5
Organism Dog
Family 5
Subfamily P
Pseudo No
Location chr21:31,359,700-31,360,600 (+)
Aliases cOR5P5

Sequence information


Nucleotide sequence

ATGGAGACTGAAAACCATACAATGGTGACAGAGTTCATTATTTTGGGGTTAACAGAGGAT
CCTACACTTTGTACCATCTTCTTTGTGGTTTTTCTAGGAATCTATGTCGCTACCCTACTG
GGCAATGTCAGCATAATCATGCTGATCCACAGAAGTCCTCAGCTTCACACCCCAATGTAT
CTTTTCCTCAGCCATTTAGCCTTTGTGGATATCGGGTATTCCACGTCAGTCACACCCATT
ATGATTGTGGGTTTCTTAAGAGAGAGAACTACTATCCCTGTTGCTGGCTGCATAGCTCAG
CTTGGCTCTGATGTTATCTTTGGAACAGCTGAGTGCTTCCTGCTGGCCGCCATGGCCTAT
GATCGCTATGTGGCCATCTGCTCTCCACTTCTCTACTCTACACACATGTCTTCCAGAGTC
TGCATCATCCTCTTGGCTGCTTCCTATCTGGGGGGATGTGTGAATGCTTCATCATTTACT
GGCTGTCTACTGAGCTTGACTTTCTGTGGACCAAATAAAATCAATCATTTCTTTTGTGAC
TTCCCACCACTAGTAAAGCTTTCTTGTACCCATATTTATGTTGCTGAAACATCACCTGCT
ATCCTAGCCGGGTCCATCATTGTAATCACACTGTTTATCATAGCTATTTCATATCTATAC
ATCCTGCATTCAGTCCTAAATATGCGCTCCCCTGAAGGAAGACACAAGGCCTTCTCCACT
TGTACTTCTCACCTCAGTGCAGTCACTTTGTTTTATGGGACAGTCACATTTGTTTATGTC
ATACCCAAGTCAGATTACTCGTCTGATCATATTAAAGTGGTGTCTGTGTTCTACACAGTG
GTGATCCCCATGTTGAACCCCTTGATCTATAGTCTGAGAAACAAAGAGGTTAAAGAGGCC
ACGAGAAAATTGATGGCTAGAAGACATTGGTTATTT


Conceptual translation

METENHTMVTEFIILGLTEDPTLCTIFFVVFLGIYVATLLGNVSIIMLIHRSPQLHTPMY
LFLSHLAFVDIGYSTSVTPIMIVGFLRERTTIPVAGCIAQLGSDVIFGTAECFLLAAMAY
DRYVAICSPLLYSTHMSSRVCIILLAASYLGGCVNASSFTGCLLSLTFCGPNKINHFFCD
FPPLVKLSCTHIYVAETSPAILAGSIIVITLFIIAISYLYILHSVLNMRSPEGRHKAFST
CTSHLSAVTLFYGTVTFVYVIPKSDYSSDHIKVVSVFYTVVIPMLNPLIYSLRNKEVKEA
TRKLMARRHWLF