Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5W2 Olfactory Receptor

Gene Symbol OR5W2
Organism Dog
Family 5
Subfamily W
Pseudo No
Location chr18:40028989-40029918 (+)
Aliases cOR8W1, cOR8W1

Sequence information


Nucleotide sequence

ATGGACAAAGGAAATTGCTCTTCCTTGACTGAATTCTTTTTCTTGGGAATTACCAATAAT
CCTGAGATGAAAGTGACCCTATTCACCATCACTCTGGTTATTTATCTCATTAATCTCCTG
GCAAATCTTGGAATGATTATTCTAATTAGAATGGATTTTCAGCTGAATACACCAATGTAC
TTTTTCCTCAGCCATCTCTCTTTCTGTGACCTCTGTTATTCCACAGCAATTGGGCCCAAG
ATGCTGGTGGATCTATTTGCCAAAAACAAATCAATTCCTATCATAGGCTGTGCTCTGCAA
TTCTTGATCTTCTGTACTTTTGTAGATTCTGAGTGTCTACTGCTGGCAGTGATGGCATTT
GATCGGTACAAGGCCATTAGCAACCCGTTACTCTACACAGTCAACATGTCCAACAGAGTG
TGCTCCCTGCTGATGGCTGGAGTTTACTTGCTGGGAACGGCAGATGCTTTGATACACACA
ACATTAACATTCAGTTTATGTTTCTGTGGATCAAATGAGATTAATCATTTCTTCTGTGAT
GTACCTCCTCTCCTATTGCTCTCATGCTCAGATACACAGGTGAATGAGTTAGTGATATTC
ACCATTTTCGGCTTCATTGAACTGAGTACCATCACAGGAGTCCTTGTCTCTTATTGTTAT
ATAATCTTATCAGTCTTAAAGATCCGCTCTGCTGAAGGGAGGTTCAGAGCTTTCTCCACC
TGCACCTCCCACTTAACTGCTGTTGCAATTTTCCAGGGAACTATGCTCTTTATGTATTTC
CGGCCAAGCTCTTCCTACTCCCTTGATCAAGACAAAATTACTTCATTGTTTTACACCCTT
GTGATTCCCATGTTAAACCCACTGATTTATAGCCTACGGAACAAAGATGTGAAAGGGGCC
CTAGAAAAATTGAAAAATAAAATATGTCTT


Conceptual translation

MDKGNCSSLTEFFFLGITNNPEMKVTLFTITLVIYLINLLANLGMIILIRMDFQLNTPMY
FFLSHLSFCDLCYSTAIGPKMLVDLFAKNKSIPIIGCALQFLIFCTFVDSECLLLAVMAF
DRYKAISNPLLYTVNMSNRVCSLLMAGVYLLGTADALIHTTLTFSLCFCGSNEINHFFCD
VPPLLLLSCSDTQVNELVIFTIFGFIELSTITGVLVSYCYIILSVLKIRSAEGRFRAFST
CTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKITSLFYTLVIPMLNPLIYSLRNKDVKGA
LEKLKNKICL