Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5W2B Olfactory Receptor

Gene Symbol OR5W2B
Organism Dog
Family 5
Subfamily W
Pseudo No
Location chr18:40,007,700-40,008,700 (+)
Aliases cOR5W8

Sequence information


Nucleotide sequence

ATGGATAAAGGAAATTGCTCATCCTTGACAGAATTCATTTTCTTGGGAATTACCAATAAC
CCTGGAATGAAAGTGACCCTATTTGCAACGTTTCTTGTTGTTTATCTCATTAATCTGTTT
GCAAATCTTGGAATGATTATTTTAATTATAATAGATTCCCAGCTTCACACACCAATGTAC
TTTTTCCTTAGTCAACTCTCTTTCTGTGACCTCTGCTATTCTACAGCGGTTGGGCCCAAA
ATGTTGGTAGACCTTTTAGCTAAAAACAAATCAATCCCCTTCTTTGGGTGTGCCCTTCAA
TTCTTGATCTTCTGTATGTTTGCTGATTCTGAGTGTCTACTGCTGGCAGTGATGGCCTTT
GATCGGTACAAGGCCATTGGCAACCCGTTGCTCTACACAGTCAACATGTCCAACAGAGTG
TGCTCCCTGCTCATGGCTGGAGTTTACTTGCTGGGAATGGCAGATGCTCTGATACATACA
ACATTAACATTCCGCTTATGCTTTTGTGGATCAAATGAGATTAATCATTTCTTCTGTGAT
TTACCTCCACTCTACCTCCTTTCATGCTCAGATACAGAGATCAATGAGTTGGCATTATTC
ATCTTTTTTGGCTTCATTGAACTGAGCACCATTTCTGGAGTTCTTATCTCTTATTGTTAT
ATAACCCTATCAGTCTTGAAGATCCGCTCTGCTGAGGGGAGGTTCAAAGCTTTCTCCACC
TGCACCTCCCACTTAACTGCTGTTGCAATTTTCCAGGGAACTATGCTCTTCATGTATTTT
CGGCCAAGCTCTTCCTACTCCCTTGATCAAGATAAAATGACCTCATTGTTTTACACCCTT
GTGATTCCCACATTAAACCCACTGATTTATAGCCTACGGAACAAGGATGTGAAAGAAGCG
CTGAAAAAACTGAAAATTAAAAAGTGGTTT


Conceptual translation

MDKGNCSSLTEFIFLGITNNPGMKVTLFATFLVVYLINLFANLGMIILIIIDSQLHTPMY
FFLSQLSFCDLCYSTAVGPKMLVDLLAKNKSIPFFGCALQFLIFCMFADSECLLLAVMAF
DRYKAIGNPLLYTVNMSNRVCSLLMAGVYLLGMADALIHTTLTFRLCFCGSNEINHFFCD
LPPLYLLSCSDTEINELALFIFFGFIELSTISGVLISYCYITLSVLKIRSAEGRFKAFST
CTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPTLNPLIYSLRNKDVKEA
LKKLKIKKWF