Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6A2 Olfactory Receptor

Gene Symbol OR6A2
Organism Dog
Family 6
Subfamily A
Pseudo No
Location chr21:30254197-30255177 (-)
Aliases cOR6A2, cOR6A2

Sequence information


Nucleotide sequence

ATGGAGCAGAGCAACCAGAGTGGAAGGGTAAGTGAGTTTGTGTTGCTGGGCTTCCCAGCT
CCTGCACCACTGCGGGCACTTTTATTTGCCCTTTCTCTGCTAGCCTATGTGTTGGTGCTG
ACTGAAAATACACTCATCATTGTGGCAATTAGGAGCCATCCCACCCTTCACAAACCCATG
TACTTTTTTCTGGCGAATATGTCCTTCTTGGAGATATGGTATGTTACTGTCACTATTCCG
AAGATGTTAGCTGGCTTTGTTGGGTCAAAACAGAGCCATGGACAGCTAATCTCCTTTGAG
GGCTGCATGACACAGCTCTACTTTTTCCTGGGACTGGGCTGCACTGAGTGTGTCCTTCTT
GCTGTTATGGCCTATGATCGTTATGTGGCCATCTGTCATCCTCTCCACTATGGTGTCATT
GTCAGTGGCCGGCTGTGTGTGCAGCTAGCAACTGGCTCCTGGACTGGAGGCTTTGGCATC
TCCATGGTCAAAGTTTTTCTCATTTCTCGCCTCTCCTACTGTGGACCCAACATCATCAAC
CACTTTTTCTGTGATGTCTCCCCATTGCTCAATCTTTCATGCACTGACATGTCAACAGCA
GAGCTTACAGACTTTGTTCTGGCCATTTTTATCCTGCTGGGGCCACTCTCTGTCACTGGG
GCCTCCTACATGGCCATCACTGGTGCTGTAGTGCGCATTCCTTCAGCTGCTGGGCGCCAT
AAAGCCTTTTCCACCTGTGCCTCTCACCTTACTGTTGTGATCATCTTCTATGCAGCCAGT
ATCTTCATCTACGCCCGGCCAAAGGCACTCTCAGCTTTTGACACCAACAAGCTAGTTTCT
GTACTCTATGCTGTCATTGTACCATTGCTTAACCCTATCATTTACTGCTTGCGCAATCAA
GAGGTGAAGAGAGCCCTACGCCGCACTCTGCACCTCTACCAGGGCCAGGATACTAAGCAC
AGGAAAGCTAGTAGAGGTGGA


Conceptual translation

MEQSNQSGRVSEFVLLGFPAPAPLRALLFALSLLAYVLVLTENTLIIVAIRSHPTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQSHGQLISFEGCMTQLYFFLGLGCTECVLL
AVMAYDRYVAICHPLHYGVIVSGRLCVQLATGSWTGGFGISMVKVFLISRLSYCGPNIIN
HFFCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTGASYMAITGAVVRIPSAAGRH
KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKRALRRTLHLYQGQDTKHRKASRGG