Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C2 Olfactory Receptor

Gene Symbol OR6C2
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chrUn_JH373254:248,494-249,462 (+)
Aliases cOR6C46P

Sequence information


Nucleotide sequence

ATGGTTAGATTTCAAAAGTCAGTGATGAGAAACTATACAGCAATAACAACTTTTATCCTG
TTGGGACTGACAGACGACCCACAACTGCAAATCCTGCTCTTTATCTTTCTATTTCTCACC
TACATCTTGAGCGTAACAGGGAACCTGACTATTATCACCCTCACACTGGTGAACTCCCAT
CTTAAAACTCCTATGTACTTTTTTCTGAGAAATTTCTCCTTCTTAGAAGTGTCATTCACC
ACTGTCTGCATTCCTAGATTCCTGTATAGTATATCAACAGGGGACAATACTATTACCTAC
AATGCTTGTGCAAGTCAAATATTTTTTGTTATTCTCTTTGGAGCAACTGAATTTTTTCTC
CTGGCAGCCATGTCCTATGATCGCTATGTTGCTATCTGTAAACCACTTCATTACATGACC
ATCATGAGCAATAGGGTGTGTAGCTTATTAGTCTTCTGCTGTTGGGTGTCTGGCTTGATG
ATCATTCTCCCACCCCTTAGCTTGGGCCTCCAGCTGGAATTCTGTGACTCCAATGCCATT
GATCATTTTAGCTGTGATGCAGGTCCCCTCCTGAAGATCTCATGTTCAGATACATGGATG
ATAGAGCAAATGGTTATTCTTGTGGCTGTATTTGCACTCATTATCACCTTAGTGTGTGTA
TTTCTGTCCTACACATACATCATCAGGACGATTCTGAGATTCCCCTCTGTCCAACAAAGA
AAAAAGGCCTTTTCCACCTGCTCATCCCACATGATTGTAGTTTCCATCACCTATGGAAGC
TGCATCTTCATCTATGTCAAGCCATCAGCAAAAGAAGAGATAGCCATAAATAAAGGTGTT
TCGGTGCTCACTACTTCTGTTGCACCCTTGTTGAACCCCTTCATTTACACCTTGAGAAAT
AAGCAAGTGAAACAAGCTTTTAATGACTTCATAAAGAAGATGACATTTCACTCAATGAAA
CTGAAGTTT


Conceptual translation

MVRFQKSVMRNYTAITTFILLGLTDDPQLQILLFIFLFLTYILSVTGNLTIITLTLVNSH
LKTPMYFFLRNFSFLEVSFTTVCIPRFLYSISTGDNTITYNACASQIFFVILFGATEFFL
LAAMSYDRYVAICKPLHYMTIMSNRVCSLLVFCCWVSGLMIILPPLSLGLQLEFCDSNAI
DHFSCDAGPLLKISCSDTWMIEQMVILVAVFALIITLVCVFLSYTYIIRTILRFPSVQQR
KKAFSTCSSHMIVVSITYGSCIFIYVKPSAKEEIAINKGVSVLTTSVAPLLNPFIYTLRN
KQVKQAFNDFIKKMTFHSMKLKF