Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C2D Olfactory Receptor

Gene Symbol OR6C2D
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chr3:31362526-31363494 (+)
Aliases cOR6C24P, cOR6C24P

Sequence information


Nucleotide sequence

ATGGTTAGATTTCAAAAGTCAGTGATGAGAAACTATACAGCAATAACAACTTTTATCCTG
CTGGGACTGACAGACGACCCACAACTGCAAATCCTGCTCTTTATCTTTCTATTTCTCACC
TACATCTTGAGCGTAACAGGGAACCGGACTATTATCACCCTCACTCTGGTGAACTCCCAT
CTTAAAACTCCTATGTACTTTTTTCTGAGAAATGTTTCCTTCTTAGAAGTGTCATTCACC
ACTGTCTGCATTCCTAGATTCCTGTATAGCATATCAACAGGGGCCAATACTATTACCTAC
AATGCTTGTGCAAGTCAAATATCTTTTGTTATTCTCTTTGGAGCAACTGAATTTTTTCTC
CTGGCAGCCATGTCCTATGATCGCTATGTTGCTATCTGTAAACCACTTCATTACATGACC
ATCATGAGCAATAGGGTGTGTAGCTTATTAGTCTTCTGCTGTTGGGTGTCTGGCTTGATG
ATCATTCTCCCACCCCTTAGCTTGTGCCTCCAGCTGGAATTCTGTGACTCGAATGCCATC
GATCATTTTAGCTGTGATGCAGGTCCCCTCCTGAAGATCTCATGTTCAGATACATGGATG
ATAGAACAAATGGTTATCCTTGTGGCTGTATTTGCACTCATTATCACCTTAGTGTGTGTA
TTTCTGTCCTACACATACATCATCAGGACAATTCTGAGATTCCCCTCTGTCCAACAAAGA
AAAAAGGCCTTTTCCACCTGCTCATCCCACATGATTGTAGTTTCCATCACCTATGGAAGC
GGCATCTTCATCTATATCAAGTCATCAGCAAAAGAAGAGATAGCCATAAATAAAGGTGTT
TCGGTGCTCACTACTTCTGTTGCACCCTTGCTGAACCCCTTCTTTTACACCTTGAGAAAT
AAGCAAGTGAAACAAGCTTTTAATGACTTCATAAAGAAGATGACATTTCACTCAAAGAAA
CTGAAGTTT


Conceptual translation

MVRFQKSVMRNYTAITTFILLGLTDDPQLQILLFIFLFLTYILSVTGNRTIITLTLVNSH
LKTPMYFFLRNVSFLEVSFTTVCIPRFLYSISTGANTITYNACASQISFVILFGATEFFL
LAAMSYDRYVAICKPLHYMTIMSNRVCSLLVFCCWVSGLMIILPPLSLCLQLEFCDSNAI
DHFSCDAGPLLKISCSDTWMIEQMVILVAVFALIITLVCVFLSYTYIIRTILRFPSVQQR
KKAFSTCSSHMIVVSITYGSGIFIYIKSSAKEEIAINKGVSVLTTSVAPLLNPFFYTLRN
KQVKQAFNDFIKKMTFHSKKLKF