Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C2E Olfactory Receptor

Gene Symbol OR6C2E
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chr3:31504057-31505025 (-)
Aliases cOR6C59P, cOR6C59P

Sequence information


Nucleotide sequence

ATGGTTAGATTTCAAAAGTCAGTGATGAGAAACTATACAGCAATAACAACTTTTATCCTG
CTGGGACTGACAGACGACCCACAACTGCAAATCCTGCTCTTTATCTTTCTATTTCTCACC
TACATCTTGAGCGTAACAGGGAACCGGACTATTATCACCCTCACACTGGTGAACTCCCAT
CTTAAAACTCCTATGTACTTTTTTCTGAGAAATGTTTCCTTCTTAGAAGTGTCATTCACC
ACTGTCTGCATTCCTAGATTCCTGTATAGCATATCAACAGGGGCCAATACTATTACCTAC
AATGCTTGTGCAAGTCAAATATTTTTTGTTATTCTCTTTGGAGCAACTGAATTTTTTCTC
CTGGCAGCCATGTCCTATGATCGCTATGTTGCTATCTGTAAACCACTTCATTACATGACC
ATCATGAGCAATAGGGTGTGTAGCTTATTAGTCTTCTGCTGTTGGGTGTCTGGCTTGATG
ATCATTCTCCCACCCCTTAGCTTGTGCCTCCAGCTGGAATTCTGTGACTCGAATGCCATC
GATCATTTTAGCTGTGATGCAGGTCCCCTCCTGAAGATCTCATGTTCAGATACATGGATG
ATAGAACAAATGGTTATCCTTGTGGCTGTATTTGCACTCATTATCACCTTAGTGTGTGTA
TTTCTGTCCTACACATACATCATCAGGACAATTCTGAGATTCCCCTCTGTCCAACAAAGA
AAAAAGGCCTTTTCCACCTGCTCATCCCACATGATTGTAGTTTCCATCACCTATGGAAGC
GGCATCTTCATCTATATCAAGTCATCAGCAAAAGAAGAGATAGCCATAAATAAAGGTGTT
TCGGTGCTCACTACTTCTGTTGCACCCTTGCTGAACCCCTTCTTTTACACCTTGAGAAAT
AAGCAAGTGAAACAAGCTTTTAATGACTTCATAAAGAAGATGACATTTCACTCAAAGAAA
CTGAAGTTT


Conceptual translation

MVRFQKSVMRNYTAITTFILLGLTDDPQLQILLFIFLFLTYILSVTGNRTIITLTLVNSH
LKTPMYFFLRNVSFLEVSFTTVCIPRFLYSISTGANTITYNACASQIFFVILFGATEFFL
LAAMSYDRYVAICKPLHYMTIMSNRVCSLLVFCCWVSGLMIILPPLSLCLQLEFCDSNAI
DHFSCDAGPLLKISCSDTWMIEQMVILVAVFALIITLVCVFLSYTYIIRTILRFPSVQQR
KKAFSTCSSHMIVVSITYGSGIFIYIKSSAKEEIAINKGVSVLTTSVAPLLNPFFYTLRN
KQVKQAFNDFIKKMTFHSKKLKF