Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C2IP Olfactory Receptor

Gene Symbol OR6C2IP
Organism Dog
Family 6
Subfamily C
Pseudo Yes
Location chr10:16,101,200-16,102,100 (+)
Aliases cOR6C26

Sequence information


Nucleotide sequence

ATGAGAAACTATACAGCAATAACAACTTTTATCCTGCTGGGTCTGACAGACGACCCACAA
CTGCAAATCCTGCTCTTTATCTTTATATTTCTCACCTACATCTTGAGCGTAACAGGAAAC
CTGACTATTATCACCCTCACACTGGTGAACTCCCATCTTAAAACTCCTATGTACTTTTTT
CTGAGAAATTTCTCCTTCTTAGAAGTGTCATTCACCACTGTCTGCATTCCTAGATTCCTG
TATAGTATATCAACAGGGGACAATACTATTACCTACAATGCTTGTGCAAGTCAAATATTT
TTTTTGTTATTCTCTTTGGATCAACTGAATTTTTTCTCCTGGCCGCCATGTCCTATGATC
GCTATGTTGCTATCTGTAAACCACTTCATTACATGACCATCATGAGCAATAGGGTGTGTA
GCTTATTAGTCTTCTGCTGTTGGGTGTCTGGCTTGATGATCATTCTCCCACCCCCTAGCT
TGTGCCTCCAGCTGGAATTTTGTGACTCCAATGCCATTGATCATTTTAGCTGTGATGCAG
CTCCCCTCCTGAAGATCTCATGTTCAGATACATGGATGATAGAACAAATGGTTATCCTTG
TGGCTGTATTTGCACTCATTATCACCTTAGTGTGTGTATTTCTGTCCTACACATACATCA
TCAGGACCATTCTGAGATTCCCCTCTGTCCAACAAAGAAAAAAGGCCTTTTCCACCTGCT
CATCCCACATGATTGTAGTTTCCATCACCTATGGAAGCGGCATCTTCATCTATATCAAGC
CATCAGCAAAAGAAGGGATAGCCATAAATAAAGGTGTTTCGGTGCTCACTACTTCTGTTG
CACCCTTGCTGAACCCCTTCTTTTACACCTTAAGAAATAAGCAAGTGAAACAAGCTTTTA
ATGACTTCATAAAGAAGATGACATTTCACTCAAAGAAACTGAAGTTT


Conceptual translation

MRNYTAITTFILLGLTDDPQLQILLFIFIFLTYILSVTGNLTIITLTLVNSHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYSISTGDNTITYNACASQIFFLLFS/GSTEFFLLAAMSY
DRYVAICKPLHYMTIMSNRVCSLLVFCCWVSGLMIILPPPSLCLQLEFCDSNAIDHFSCD
AAPLLKISCSDTWMIEQMVILVAVFALIITLVCVFLSYTYIIRTILRFPSVQQRKKAFST
CSSHMIVVSITYGSGIFIYIKPSAKEGIAINKGVSVLTTSVAPLLNPFFYTLRNKQVKQA
FNDFIKKMTFHSKKLKF