Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C76P Olfactory Receptor

Gene Symbol OR6C76P
Organism Dog
Family 6
Subfamily C
Pseudo Yes
Location chr3:31,339,000-31,339,900 (+)
Aliases cOR6C60P

Sequence information


Nucleotide sequence

ATGAATAATAGAACATCAGTGACCAACTTCATCCTCCTGGGTCTGACCGACAATCCAGAA
ATACAGGCTGTAAATTTCCTCTTTCTATTTCTCACCTACGTACTGAGTGTTACTGGAAAT
CTCACCATCATCATTCTTACCCTGCTGGATTCCCACCTGGAGGCTCCCATGTATTTTTTC
CTCCGAATTTCTCCTTAGAAATTTCATTCACTTCTGTCTGTAATCCTAGATTTTTCATCA
GCATCGTAACTGGAGACAAATCTATTTCCTATAATGCTTGTGCAGCTCAGCTATTTTTCT
TTGTCCTCCTTGGCTAACCAGTTTTTCTTCTGGCTGCTATGTCCTATGATCATTATGCGG
CTATCTGCAAGCTTCTACATTATACAACCACCATGAGTAACAAGATTTGCTACCAGCTTG
TAGTCAGCTCTTGGGTGGCTGGTTTCTTGGTAATCTTCCCACCACTAGCCATGGGTCTGC
AGTTGGATTTCTGTGACTCCAATGTCATTGACCACTTCACCTATGATTCTGCTCCTTTAC
TCCAAATGTCTTGCACAGACACAAGTACTCTAGAGCTCATGAGCTTTGTTTTAGCCATAC
TTACTCTTATGTCCACTTTGATGTTAGTAATTCTCTCCCACTCTTACATCCTTAGAACAA
TTCTGAAAATCCCTTCAGCTCAACAAAGAAAAAAGGCCTTCTCAACCTGCTCCTCCCATA
TGATAGTTGTCTCTATCTCTTATGGGAGCTGCATCTTCATGTATGTCAAAACATCAGCAA
AGGAAGGGGTTGCTTTGACAAAAGGTGTGGCTATGCTCAGTACCTCTGTTGCTCTCATGC
TGAATCCATTTATTTACACTTTAAGGAACCAGCAGGTGAAAGAAGCATTTAAGGACGTTG
TGAAAAAGATACTTTTCTCAAAACCATTGATC


Conceptual translation

MNNRTSVTNFILLGLTDNPEIQAVNFLFLFLTYVLSVTGNLTIIILTLLDSHLEAPMYFF
L/NFSLEISFTSVCNPRFFISIVTGDKSISYNACAAQLFFFVLLG*PVFLLAAMSYDHY
AAICKLLHYTTTMSNKICYQLVVSSWVAGFLVIFPPLAMGLQLDFCDSNVIDHFTYDSAP
LLQMSCTDTSTLELMSFVLAILTLMSTLMLVILSHSYILRTILKIPSAQQRKKAFSTCSS
HMIVVSISYGSCIFMYVKTSAKEGVALTKGVAMLSTSVALMLNPFIYTLRNQQVKEAFKD
VVKKILFSKPLI