Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6F1 Olfactory Receptor

Gene Symbol OR6F1
Organism Dog
Family 6
Subfamily F
Pseudo No
Location chr14:1184172-1185131 (+)

Sequence information


Nucleotide sequence

ATGGTCTCTATTTACAGGTATACCTCAGTATTTTCAATGGGCACAGACAATGCAACCCGT
CACCAGGATTTTCTCCTGCTGGGCTTTCCTGGGTCCCAGGTCCTTCAGCTATCTCTCTTT
ATGCTTTTTCTGGTAATGTACATTCTCACAGTGGGTGGGAACATGGCTATCTTGATGCTG
GTGAGTACCTCCCACCAGCTACATACCCCGATGTACTTCTTTCTGAGCAACCTTTCTTTC
TTGGAGATTTGGTATACCACAGCTGCAGTCCCCAAAGCCCTGGCCATCCTTCTGGGGAGA
AGCCAAACCATAACATTTACTGGCTGCCTTTTGCAGATGTACCTTGTTTTCTCATTGGGC
TGCACAGAGTACTTCCTCCTGGCAGCCATGGCTTACGACCGCTATCTGGCCATCTGCTAT
CCTCTACACTATGGGGCCATCATGAATAGCCTGCTCTCAGCACAGCTAGCCCTGGGATCA
TGGCTGTGCGGTTTTCTGGCCATTTCAGTGCCCACAGCTCTCATCAGCACCCTGTCCTTC
TGTGGTTCCCGCACTATCAACCACTTCTTCTGTGACATTGCACCCTGGATCACCCTGGCT
TGTACCAGCACACAGGCCGTGGAACTCGTGGCCTTTGTGATTGCTTTTGTGGTCATCCTG
AGTTCATGCCTCATCACCTTGGTCTCCTACATCTATATCATCAGCACAATTCTCAGGATC
CCTTCGGCCAGCAGCAGGAGCAAAGCCTTCTCCACATGCTCTTCACATCTCACTGTGGTG
CTCATCTGGTATGGGTCCACCATCTTTCTTCATGTCCGCCTCTCCATCAAAGAGTCCTTG
GACCTGACCAAAGCCATTCATGTCCTGAACACTGTGGTGACTCCAGTTCTAAATCCCTTC
ATCTACACTCTCCGTAATAAAGAAGTAAGGGAAACTCTGCTGAAGAAGTGGAAGGGGAAT


Conceptual translation

MVSIYRYTSVFSMGTDNATRHQDFLLLGFPGSQVLQLSLFMLFLVMYILTVGGNMAILML
VSTSHQLHTPMYFFLSNLSFLEIWYTTAAVPKALAILLGRSQTITFTGCLLQMYLVFSLG
CTEYFLLAAMAYDRYLAICYPLHYGAIMNSLLSAQLALGSWLCGFLAISVPTALISTLSF
CGSRTINHFFCDIAPWITLACTSTQAVELVAFVIAFVVILSSCLITLVSYIYIISTILRI
PSASSRSKAFSTCSSHLTVVLIWYGSTIFLHVRLSIKESLDLTKAIHVLNTVVTPVLNPF
IYTLRNKEVRETLLKKWKGN