Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6K3 Olfactory Receptor

Gene Symbol OR6K3
Organism Dog
Family 6
Subfamily K
Pseudo No
Location chrUn_JH374157:3632-4705 (+)
Aliases cOR6K10, cOR6K10

Sequence information


Conceptual translation

MEGANLSAVTEFVFTGFPQLQDGGLLYFFPLLFIYTFVVVGNLLIFFAVRMDVRLHNPMY
NFISTFSFLEVWYTTATIPKMLSNLVSEKKTISMTGCLLQMYFFHSLGNSEAILLITMAI
DRYVAICNPLRYQMIMTPRLCAQLSAGSCIFGFLILLPEIVTISTLPFCGPNQIHQIFCD
LVPVLRLACTNASVILVEDVIHAVAIIITILIIALSYIRIVSVILRIPSAEGRQKAFSTC
GGHLTVFLIFFGSVSLMYLRFNATYPPALDTAIALMFTVLAPFFHPIIYSLRNKDMKNAI
RKLVQGIPGWLSGLAPAFGPRRDPGVPGSSPTSGSRCMEPASPSACICLSVSLSVYHK