Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6K6 Olfactory Receptor

Gene Symbol OR6K6
Organism Dog
Family 6
Subfamily K
Pseudo No
Location chr38:23003883-23004839 (-)
Aliases cOR6K7, cOR6K7

Sequence information


Nucleotide sequence

ATGACACGGCTGGAGACCCTGGGGAATCAGACTATGGTGACTGAGTTCTTGTTCTCTGTG
TTCCCACCTCTGCATCAAGGTGGCCTCCTGTTTTTCATCCCCCTGCTTCTCGCCTATGGA
TTCATCATCACTGGGAACCTGGTGATAGTCATTGTGGTCCAGCTGGACATGGCCCTGCAC
ACTCCCATGTACTTCTTCATCAGTGTCCTCTCCTTCCTGGAGGTCGGGTACACCACGACC
ACCATCCCCAAGATGCTCTCCAGCCTGGTCAATGAGCAGAAGACCATCTCTCTGGCCGGC
TGCCTCCTGCAGATGTACTTCTTCCACTCCCTGGGCATCACGGAAGGCTGTGTGCTGACA
GCAATGGCCATTGACAGGTACGTCGCCATCTGCAGTCCTCTCCGTTACCCGACCATCATG
ACTCCCAAGCTGTGCACCCAGCTAACAGCTGGGTCCTGCCTCTGTGGCTTCCTCCTTGTG
CTCCCTGAGATCGCGTGGATTGCCACCTTGCCTTTCTGTGGCCCCAACCGGATCCAGCAG
ATCTTCTGTGACTTCACACCTGTGTTGAGCTTGGCCTGCACAGACACATCGCTGGTGGTC
ATCGTGGACGCTATCCACGCAGTGGAGATCGTGGCCTCCTTCCTGGCCATCGCCCTATCC
TACGTCCGGATCATCGTGGTGATTCTGGGGATGCCCTCTGCTGAGGGCCGCCGCAAGGCC
TTCTCCACCTGTGCCGCTCACCTTGCTGTGTTCCTGCTCTTCTTCGGCAGTGTGGCTGTC
ATGTATCTGCGGTTCTCAGCCACCTACTCAGTGTTTTGGGACACAGCAATTGCTGTCAGC
TTTGTAATCCTTGCTCCCTTCCTCAACCCCATTATCTACAGCCTGAGAAACAAGGACATG
AAAGATGCTATTAGAAGGTTTTTCTGCCGTCGGAGGAGGGCTGGTGGGGTCAGGGGG


Conceptual translation

MTRLETLGNQTMVTEFLFSVFPPLHQGGLLFFIPLLLAYGFIITGNLVIVIVVQLDMALH
TPMYFFISVLSFLEVGYTTTTIPKMLSSLVNEQKTISLAGCLLQMYFFHSLGITEGCVLT
AMAIDRYVAICSPLRYPTIMTPKLCTQLTAGSCLCGFLLVLPEIAWIATLPFCGPNRIQQ
IFCDFTPVLSLACTDTSLVVIVDAIHAVEIVASFLAIALSYVRIIVVILGMPSAEGRRKA
FSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTAIAVSFVILAPFLNPIIYSLRNKDM
KDAIRRFFCRRRRAGGVRG